KEGG   Geospiza fortis (medium ground-finch): 102040449Help
Entry
102040449         CDS       T03755                                 

Gene name
ENTPD8
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 8
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00230  Purine metabolism
gfr00240  Pyrimidine metabolism
gfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102040449 (ENTPD8)
   00240 Pyrimidine metabolism
    102040449 (ENTPD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gfr04090]
    102040449 (ENTPD8)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     102040449 (ENTPD8)
CD molecules [BR:gfr04090]
 Proteins
  102040449 (ENTPD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 102040449
NCBI-ProteinID: XP_005423882
Position
Un
AA seq 460 aa AA seqDB search
NVKDVLLPPSTKYGLVFDAGSTHTSLYIYRWRADKENGTGIVSQVEACSVSGPGISSYAD
DPAGAGASLKPCLDRAMKIVPAEQQRENPTYPGALAGREENSSKAEQVLAEVSKAIGEYP
VDFRGARILTGSEEGSFGWITVNYLLETLVKFSFAEKWEHPQDTEVLGALDLGGASTQIT
FQPGVPVEDRNTSVFFRLYGTNYSLYSHSYLCYGQSQALKMLLAVLHQASSSPQIKHPCY
PQGYQENISVAELYDSPCVRAPSSASPGLVLTVTGTGDPAACGTAVRRLFNFSCGAQGPC
GFNGVYQPPVRGQFFAFAGFYYTFNFLNLTRQQSLSEVNTTVFSFCRRNWTELVQSFPKD
LKYLHTYCSVAFYILTLLLDGFKFNEHTWSNIHFSRQAANTDIGWTLGFMLNLTNMIPAE
ALQQVKGHQPGLWAGAISFLVLTIVAGLVAVFLHCFWKTK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
aatgtgaaggatgtgcttctgccccccagcaccaagtacggcctggtgtttgatgctggc
tccacacacacgtccctctacatctaccggtggcgcgcggacaaggagaacggcacgggc
atcgtgtcccaggtggaggcctgctctgtgtccggacccggcatctccagctacgcagat
gaccccgcgggggctggcgccagcctgaagccttgcctggacagggccatgaagatcgtc
ccggccgagcagcagcgggagaaccccacgtacccgggggcccttgctggcagggaggag
aacagcagcaaggccgagcaggtcttggccgaggtgtccaaggccattggggagtaccct
gtggatttccgcggagctcggatcctgacgggcagcgaggagggctcctttggctggatc
actgtcaactacctgctggagacactggtcaagttctcgtttgcagagaaatgggaacat
ccccaggacaccgaggttctgggagctctggacctcggcggtgcctcgacgcagatcacc
ttccagcccggggtccccgtggaggacaggaacacgtccgtgttcttccggctctacggc
accaactactccctgtacagccacagctacctgtgctatgggcagagccaggccctgaag
atgctgctggcagttctgcaccaggccagctcgagtccccagatcaagcacccctgctac
ccccaggggtaccaggagaacatcagcgtggcagagctctacgacagcccctgtgtgcgt
gcgccaagctcagccagccctggccttgtcctcacagtgacggggacaggggacccagcc
gcgtgtggcacggccgtgcggagactcttcaacttcagctgcggggcgcaggggccgtgt
gggttcaatggagtctatcagccccccgtgcggggacagttcttcgcctttgctgggttc
tactacaccttcaacttcctaaacctgacccgccagcagtctctgagtgaagtcaacacc
acagtcttttccttctgccggaggaactggacagagctggtgcagagcttcccaaaggac
ttgaagtacctgcacacctactgctctgtggccttttacatcctgacgctgctgcttgat
ggcttcaagttcaatgagcacacctggagcaacatccacttcagcaggcaggcagcaaac
acagacatcgggtggacactgggcttcatgctgaacttgaccaacatgatccctgcggag
gctctgcagcaggtcaagggccaccagcccggcctgtgggcaggggccatctccttcctc
gtgctgaccatcgtggcaggcctggtggctgttttcctgcactgtttctggaaaacaaag
tag

DBGET integrated database retrieval system