KEGG   Geospiza fortis (medium ground-finch): 102042082Help
Entry
102042082         CDS       T03755                                 

Gene name
CACNG3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04260  Cardiac muscle contraction
gfr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102042082 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102042082 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    102042082 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gfr04040]
    102042082 (CACNG3)
Ion channels [BR:gfr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102042082 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 102042082
NCBI-ProteinID: XP_014164531
Position
Un
AA seq 278 aa AA seqDB search
MLSRVLNTSSLQLRVTLSIPERLTQRRLRGAGKGTFRGVCKKIDHFPEDADYEQDTAEYL
LRAVRASSIFPILSVGLLFFGGLCVAASEFYKSKHNVILSAGIFFVSAGLSNIIGIIVYI
SANAGDPGQSDSKKSYSYGWSFYFGALSFIIAEMVGVIAVHMYIEKHRQIRARSHSELLK
RSAFTRLPPYRYRFRRRSSSRSTEPRSRDMSPISKGFSTIPSTDISMFTLSRDPSKVTMG
TLLNSERDHGFLQVHNSIPKEFKESLHNNPANRRTTPV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctcagccgggtgttaaacaccagctccctgcagctgcgtgtgacactcagcatcccc
gagcgcctcacacagcgccgtctgcgaggggctgggaaaggaaccttccgaggagtgtgc
aagaaaatcgaccacttccctgaggatgcagactacgagcaagacacggccgagtacctg
ctccgtgcagtgagagcatccagcatcttccccatcctcagcgtggggctgctgttcttc
gggggcctgtgcgtggccgccagcgagttctacaagagcaaacacaacgtcatcctcagt
gctggtatcttcttcgtctctgcaggtctcagcaacatcatcgggatcatagtgtacatc
tcggccaacgcgggggacccggggcagagcgactccaagaagagctactcctacggctgg
tccttctatttcggggcgctgtccttcatcatcgccgagatggtgggggtgatcgccgtg
cacatgtacatcgagaagcaccgccagatccgcgccaggtcccactcggagctgctcaag
aggtcggccttcacccgcctgcccccctacaggtaccgcttccgccggcggtccagctcc
cgctccaccgagccccgctcccgggacatgtcgcccatcagcaaagggttcagcaccatc
ccctccaccgacatctccatgttcacgctctccagggatccctccaaggttaccatgggg
acgctgctcaactcggagcgggaccacggttttttacaggtccataactccatccccaaa
gagttcaaggagtctttgcacaacaacccggccaacagacgaaccacgccggtctga

DBGET integrated database retrieval system