KEGG   Geospiza fortis (medium ground-finch): 102042212Help
Entry
102042212         CDS       T03755                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04136  Autophagy - other
gfr04140  Autophagy - animal
gfr04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102042212 (ATG16L1)
   04136 Autophagy - other
    102042212 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102042212 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102042212 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:gfr03029]
    102042212 (ATG16L1)
Membrane trafficking [BR:gfr04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102042212 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    102042212 (ATG16L1)
Mitochondrial biogenesis [BR:gfr03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102042212 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ERM Fez1 KASH_CCD Peptidase_M15_4 HTH_6 WD40_like Lipoprotein_6 V_ATPase_I YabA YicC_N
Motif
Other DBs
NCBI-GeneID: 102042212
NCBI-ProteinID: XP_005430271
Position
Un
AA seq 545 aa AA seqDB search
MQSRHEISPGHDSTWNDAQLQELAQLKIKHQEELTELHKKRGELAQSVIDLNNQMQQKDK
EMQMNEAKIAEYLQKISELETECQELRSKLQDLERANQTLKDEYDALQITFNALEEKLRK
TTEDNQELVSRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEPDDDIEV
LADETSDTAEETSPVRAVSRTSSKRLSQPAGGLLDSISNIFGRRSLSSFPAPQDNAEPHP
GASKEVRVPTTAICVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVLGDRCEPKGSL
SGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDNRLRHTLTGHSGKVLSAKFLLDNAR
IVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRTESIV
KELELFGRITALDLNPERTELLTCSRDDLLKIIDLRVSAVKQTFSAQGFKCGSDWTRVVF
SPDGNYVAAGSADGALYIWNVLTGKLERTLAKHHSSSINAVTWSPSGAHVVSVDKGNKAV
LWAEF
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcagacatgagatcagccccggacatgatagcacatggaacgacgctcagctg
caggaactggcccagctgaagataaagcaccaagaggagctgactgagctgcacaagaaa
cgtggcgagctggcccagtctgtaattgatttaaacaaccaaatgcagcagaaggacaaa
gagatgcagatgaatgaagccaagattgcagagtatttgcaaaagatttctgaactggaa
acagagtgccaggaattgcgtagcaaactgcaagatcttgagcgggctaatcagacactg
aaagatgaatatgatgctctccagatcaccttcaatgccttggaggagaaactaaggaaa
actactgaggacaaccaggagctggtctcacgttggatggcagagaaagcgcaagaagcc
aatcgtttgaatgcagaaaatgaaaaggattcaaggagacgccaggccaggctgcagaag
gagctggcagaagctgccaaagaacccttgcctgttgaaccggatgatgacatcgaagtg
ctcgcagatgaaacctctgacacagctgaggaaacctctccagtgcgagctgtcagccgg
acgtccagtaagcgactctcccagccagctggaggccttctggactctatcagtaatatc
tttgggaggcgttctctgtcctcgttccctgccccccaggataatgcagagccacatcca
ggtgccagtaaagaagtgagagtgcccactactgccatttgtgtctttgatgcacatgat
ggggaggtgaatgcggtgcagttcagccctggctcccggttactagcaacaggaggcatg
gaccggagggttaagctttgggaagtcttgggagataggtgtgagcccaaaggttccctc
tctggcagtaacgctgggattacaagcatagaatttgatagtgctggttcttacctctta
gctgcttcaaatgactttgccagcagaatctggacagttgatgacaatcgattacggcac
accctcacaggtcacagtggtaaagttctgtcagccaagttcctgctggacaatgcacgt
attgtttcgggaagtcatgaccggaccctcaagctctgggatctccgcagcaaagtttgt
ataaaaacagtatttgcaggatctagctgcaatgacatcgtgtgtactgagcagtgtgta
atgagtggacattttgataagaaaattcgtttctgggacatcaggactgaaagcatagta
aaagaactggagttgtttggaagaatcacagctctggacctgaaccccgagcgaacagag
cttctgacctgttcccgtgatgatctgctcaagatcattgacctgcgggtcagtgctgtc
aaacagaccttcagtgcccaaggattcaaatgcggctctgactggacaagagttgtgttc
agccctgatggtaactatgtggctgctggctcagctgatggggccctctacatttggaat
gtgcttactgggaaattggagaggacgcttgcaaagcatcacagttcttctatcaatgca
gtcacgtggtcaccatcgggtgcccacgtggtcagtgtggacaaaggaaacaaggctgtg
ctgtgggctgagttctga

DBGET integrated database retrieval system