KEGG   Geospiza fortis (medium ground-finch): 102043124
Entry
102043124         CDS       T03755                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gfr01002]
    102043124 (ADAMTS13)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102043124 (ADAMTS13)
Peptidases and inhibitors [BR:gfr01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102043124 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 TSP1_CCN Reprolysin_3 Reprolysin_5 Pep_M12B_propep Reprolysin_2 Peptidase_M10 DUF3810 Fve
Other DBs
NCBI-GeneID: 102043124
NCBI-ProteinID: XP_014162643
UniProt: A0A6I9Z8M1
Position
Un
AA seq 1387 aa
MTVSLALRALAVLPLGLCWLPEKFLGALDAGDVLSYFGTSSVADVPEFVVAEPACPCQEE
HFGLAPCRVQRCSIQAWGQLYAFEFLEDHALLSSSFVSSQVVNSSFVLLRRFPGSCFAGG
KALQPPGASSRVTFCEGQLQGVVTVGEEKIHIRPVRSKDVALLKDLGFSSPHILFKSAAR
EAKPARAGWAPPRLHKRAEAAVKHLELMVVAGPDVYLYHKEDTERYILANLNIGAELLRD
ASLGAHFRVHLMQMLVLREPQAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIVLY
ITRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIAHDGE
GNLCSSSGYIMGSAPCSREQFLALVSTGQTSCLNDLPDMDGSIPGWKPGLYYGADEQCKI
AFGSVATACTFADTNVDICKVLSCHVHPADKSSCTRLLVPLLDGTECGINKWCSKGQCSS
LEELNPMAVVHGHWSAWSPLSPCSRSCGGGVVLRQRFCNNPRPAFGGQDCHGASVQAEMC
NTQACLITQQDFMAEQCAATNLKPLYLDVETPSFYTWTSAVGFAKGDLLCKHMCRAVGKE
FMVSRRDNFLDGTRCEQDDTEHHGDLHVCVMGRCRAFGCDGQMGSRKAMDPCKVCGGDNS
TCTKVSGSYTEGKAEEYVTFLSLPYNTTSVHVTNRRPLFTHLAVKVKGEYVVAGKGKISL
NVTYPSVLEDKQIKYQVFLTQDNLPSLEEIHVDGPTQEEIEIQVYRRYTKKYGNATNPDI
TFSYFVPRESLSYLWVPQQGPCSVTCGEGVQPVAHVCFDQTKNEVTEDQRCLELPQPLPE
HKPCAMEPCLYRWKMAQRDECSAVCGTGVAQQNLTCVQFHDGLETVVDDSLCPAEEKPLS
LVPCVVNVCPLGWDKEEDAHLLQPLEPLGHVQLENQTVYVWSPVAGECSVSCGRGKTQLH
YVCVAFDTKEEAQEENCQPVPKPESRVEVCELNPCPPRWKVTPAGPCSSSCGLGLAVQLV
TCVQTLHGQEVLQEEHLCPVAEKPLTSVPCVIRTCSYEWSFSEWSECSTSCGNGIQTRQD
FCLSSLTHKPVNPLFCRHFPKAIVVRGCSAGPCPEQGGTQSPGAQLQPVTPATHLPTAAA
APEHRHKDLGVPLSAGPREQTKPSGGVCGNLFLNATGIINMTGVESRDCTVAIGRPLREE
ISVTILESSLNCTAGEILLFSGRMMWRTGCRKLPLSLINSRTNTLIVKQRVVLPGNGVIL
QYNSRTATKKYYQDCDQQLFGPQGEIVNPVQFPAERQGVVCRTFITVAPRQRISIRALNA
DLGPEGNHTHFNYILVRDVSTMKTVVFRGKQQFLWQSTGSQAEIEFHENVKDHRTHFWAE
YHAIEPK
NT seq 4164 nt   +upstreamnt  +downstreamnt
atgaccgtcagcttggcgctgcgggcgctcgccgtgctcccgctggggctgtgctggctc
cctgagaaattcctgggcgctctggatgcgggcgatgttctgtcttactttggaaccagc
tcagtggctgatgtacctgagtttgttgtggctgagccagcttgcccttgtcaagaagaa
cattttgggctggcgccctgtcgggtccagcgctgctccatccaggcctgggggcagctc
tatgcctttgaattcctagaggaccatgccctcctttcctcctcctttgtgagcagccag
gtggtgaactcttcctttgttttactgaggagattcccagggagctgctttgcaggtgga
aaagccctgcagcctcctggggccagcagcagagtcactttctgtgaagggcagctgcaa
ggagtggtcaccgtaggcgaggagaagattcacatcaggccagtcaggagcaaagatgtg
gctctgctgaaggacctcggcttctccagcccccacatcctcttcaaaagtgctgcaaga
gaggcaaagccagccagagcagggtgggctcctcctcgcctgcacaagagggctgaggca
gctgtcaaacatctggagctgatggtggtggcagggccagatgtttacttgtaccacaaa
gaggacacagaacgttacatcctggccaacttgaacattggagcagagctgctcagagat
gcctcactgggggctcatttcagagttcacctcatgcaaatgctggttttgagggagcca
caggcagaggtgaacatcaccaccaacatcacctcctccctcatcagtgtctgtgagtgg
agcaagaaggtgaatccccagaacgactctgacccccagcatgctgacattgtcctctac
atcaccaggtttgacctggagttgcctgatgggaacaaggagcttcgtggagtgactcag
ttagggggagtctgctcctccttctggagctgtgtcattacccaggacactggctttgac
cttggagtcaccatagcccatgagattgggcacagccttggcattgcccacgatggagag
gggaatctgtgcagcagcagtggttacatcatgggctcagctccgtgcagccgggagcag
ttcctggcccttgtcagtacaggccaaacaagctgcttgaatgacctgccggacatggac
ggcagcatcccggggtggaagcctggcttgtactatggagcagatgagcagtgtaaaatt
gcctttgggagtgtggccacagcttgcacctttgctgacaccaatgttgacatctgtaaa
gttctctcatgccatgtacatccagcagacaaatccagctgtactcggcttctggtgccc
ctcctggatggaactgagtgtgggatcaacaagtggtgctccaagggtcagtgcagctct
ctggaggaactgaaccccatggctgtggtccatgggcactggtctgcctggagccccctg
tccccctgctcccgcagctgcggcgggggggtggtgctgaggcagcgcttctgtaacaac
cccaggcctgcttttggagggcaggattgccacggtgccagcgtgcaagcagagatgtgc
aatacacaggcctgtctgatcacccagcaggacttcatggctgaacaatgtgcagcaaca
aatttaaagccactgtaccttgatgtagaaacaccatccttttatacctggacctctgct
gttggctttgccaaaggggacctgctctgcaagcacatgtgcagggctgtgggcaaggag
ttcatggtgagccgcagggacaatttcctggatggaaccaggtgtgagcaggatgacaca
gagcaccacggggatctccatgtgtgtgtcatggggagatgcagagcatttgggtgtgat
ggccagatgggctccaggaaggccatggatccctgcaaggtctgtgggggtgacaactcc
acctgcaccaaagtgagtggatcctacacagaagggaaagctgaagagtatgtgacattt
ctgtccttgccctacaacaccacctcagtccatgtcaccaacaggaggcctctcttcaca
cacctggctgtgaaggttaaaggagagtacgtggtggctgggaaaggaaaaatctcactg
aatgtcacctacccatcagttctggaggacaagcagatcaaataccaagtgtttctcacc
caggacaacctgccaagcctggaggaaatccatgtggatgggccaacacaggaagaaatt
gaaatacaggtctacaggaggtacacaaaaaaatatggcaatgccaccaacccagacatc
accttcagctattttgtccccagggagagcctgagctatctgtgggttcctcagcagggc
ccatgttcagtgacctgtggggaaggggtgcagccagtggctcatgtgtgctttgatcag
accaagaatgaagtgacagaggatcagaggtgtttggagctgccacagcccctcccagag
cacaagccctgtgccatggagccgtgcctctacaggtggaagatggctcagagagatgaa
tgctctgctgtctgtgggactggagttgcccagcagaacctgacctgtgtgcagttccat
gatggcctggagactgtggtggatgacagcctgtgcccagcagaagaaaaacccctctcc
cttgtgccatgtgtggtcaatgtctgccctttgggctgggacaaagaggaagatgcacac
ttacttcagcctctggagccacttgggcatgtccagctggaaaatcagactgtgtatgtg
tggagccctgtagctggggagtgttctgtctcctgtggtagaggtaagactcagctgcac
tatgtttgtgtggcttttgacaccaaagaagaagcccaggaggaaaactgtcagccagtg
ccaaagccagagagcagggtggaagtctgtgagctcaacccctgcccaccaaggtggaag
gtaaccccagctgggccctgctcctccagctgtgggctgggcttggcagtgcagctggtc
acctgtgtgcagaccctgcatggccaggaggtcttgcaggaggaacatttgtgccctgtg
gcagagaagcccctcaccagtgtcccctgtgtcatccgcacgtgctcttacgagtggagc
ttcagcgagtggtcagagtgttcaacatcttgtgggaatggcattcagaccaggcaggat
ttctgtctcagctctctgacccacaagcctgtgaacccccttttctgccggcacttcccc
aaggccatcgtggtgcgtggctgctctgcagggccctgtcctgagcagggggggacccag
tcccctggggcacagctgcagccagtgacaccagccacacacctgccaacagctgcagct
gccccagagcacagacacaaggacctgggtgtgcctctgtctgctgggccccgggagcag
acaaagcccagtggaggtgtctgtggaaacctgtttctcaatgccactggcatcatcaac
atgacaggcgtggagagcagggactgcacggtggccattgggcgtcccctgagggaggag
atctcagtgaccatcctggagagctccctcaactgcactgcaggtgagatcctgctgttt
tctgggcgaatgatgtggcggacaggctgcaggaagctccctctgtcactgataaattcc
agaaccaacacactgattgtgaaacagcgagttgtgctgccaggaaatggggtcattctg
cagtacaacagcagaactgcaaccaaaaaatactaccaagactgtgaccagcagctgttt
ggcccccagggtgaaatagtgaatcctgtgcagtttccagctgagaggcagggggtggtg
tgccgcactttcatcacggtggctccgcggcagcgcatctccatccgcgccctcaacgct
gacctgggccctgagggcaaccacactcacttcaactacatcctggtccgagatgtcagc
accatgaagacagtggtgttccgtgggaagcagcagttcctgtggcagtcaacaggaagc
caagctgaaattgaattccacgagaacgttaaggatcacagaacccatttctgggctgaa
tatcatgctattgagcctaaataa

DBGET integrated database retrieval system