KEGG   Geospiza fortis (medium ground-finch): 102044402Help
Entry
102044402         CDS       T03755                                 

Gene name
NMNAT2
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00760  Nicotinate and nicotinamide metabolism
gfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102044402 (NMNAT2)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     102044402 (NMNAT2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     102044402 (NMNAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 102044402
NCBI-ProteinID: XP_014163573
Position
Un
AA seq 351 aa AA seqDB search
MAVCPRAVTREHTRAVHTRAQHTRERTPHPPGSVLALFVRCCSSSGLRDCSRCSTSISSD
QGGDGTKQPQPERARDYLHKTGRFIVIGGIVSPVHDSYGKTGLVSSRHRLTMCQLAVQSS
DWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSITPVIGQPQNESSQNI
YQNNNSVSSKPTAAKILGKVGESLSRICCVRPPMERFTFVDENANLGTVMRYEEIELRIL
LLCGSDLLESFCIPGLWNEADMEVIVGEFGIVVVPRDGADPERIMNHSSILRKYKNNILV
VKDDSNHPMSVVSSTKSRLALQHGDGHVVDYLCQPVIDYILKSQLYINASG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgtgcccgcgggctgtgacacgagagcacacgcgggccgtgcacacgagagca
cagcacacacgagagcgcaccccacaccccccggggtcggtcctggcgctgtttgtccgc
tgctgctcgtcctcgggtctgcgagactgcagccgctgcagcacttccatttcctctgac
cagggaggagatggaaccaagcagccacagccagagcgagcccgggattacctgcacaag
accggacgcttcatcgtcatcggcggcatcgtctcgcccgtgcacgactcctacgggaaa
acggggctggtctccagccggcaccgcctgaccatgtgccagctggccgtgcagtcctcc
gactggatcagggtggacccctgggagtgctaccaggacacctggcagaccacctgcagc
gtgctggagcaccaccgtgacctgatgaagagagtgactggctgcatcctgtccaatgtc
aacacgccctccatcacccctgtgatcgggcagccccagaacgagtcctcgcagaacatc
taccagaacaacaacagcgtctccagcaagcccaccgcagcaaagatcttggggaaggtg
ggagaaagcctgagccggatttgctgtgttcgcccgcccatggagcgcttcacctttgtg
gatgaaaatgccaacctggggacagtgatgagatacgaggagattgagcttcgcatcttg
ctgctctgtggcagcgacctgctggagtccttctgcatccctggcctctggaacgaggca
gatatggaggtgattgtcggggagtttgggatcgtggttgtgccgcgggacggagcagac
cccgagcggatcatgaaccactcctccatcctccgcaagtacaaaaacaacatcctggtg
gtgaaggatgactcaaaccatcccatgtcagttgtcagctccaccaaaagcagactggcc
ctgcagcacggggatgggcacgttgtggattacctctgccagcctgtcattgactacatc
ctcaagagccagctgtacatcaacgcctctggctaa

DBGET integrated database retrieval system