KEGG   Gallus gallus (chicken): 100049058
Entry
100049058         CDS       T01006                                 
Symbol
DAG1
Name
(RefSeq) dystroglycan precursor
  KO
K06265  dystroglycan 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100049058 (DAG1)
SSDB
Motif
Pfam: DAG1 a_DG1_N2 TMEM154 DUF4064 TOBE_3
Other DBs
NCBI-GeneID: 100049058
NCBI-ProteinID: NP_001091009
CGNC: 59244
UniProt: A4VAR9
Position
12:complement(2863142..2901306)
AA seq 896 aa
MTVGCVPQPPFLGRTLLPVLLLAASARCHWPSEPAEVVRDWENQLEASMHSVLSDLRETV
PAVVGIPDSSAVVGRFFRVSIPTDLIASNGEAVQVSEAGKESLPSWLHWNAESSSLEGLP
LDTDKGVHYISVTTLQPFPNGSYVPQAANVFSVEVHQEDHSEPQSLRAAAQEAGDAAPFV
CGAEEPVTILTVILDADLTKMTPKQRIELLNRMRSFSEVELHNMKLVPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLSQNSVPNISKVEAPAKEGTMSARLGYPVVGWHIAN
KKPHLPKRMRRQINATPTPLTAIGPPTTAAQEPPTRIVPTPTSPAIAPPTETTAPPVREP
IPLPRKPTVTIRTRGPIVQTPTLGPIQPTRLVEGTGTVSVPIRPTVPGYVEPTAVITPPT
TTTKKPRVSTLKPATPSTTDSSTATTRRPTRRPKTPRPTKPPSTTRSTISKLTTASPPTR
VRTTASGVPRPWEPNEPPKLTNHIDRVDAWEGTYFEVKIPSDTFYDKEDTTTDKLQLTLK
LKEQQMIEENSWVQFNSTSQLMYGMPDRSHVGKHEYFMYATDKGGLFAVDAFEIHVHKRP
HGDKSPVKFKARLEGDHSAVANDIHKKIMLVKKLALAFGDRNSSTITVQDIAKGSIVVEW
TNNTLPLEPCPREQIRTLSKKIAEDSGGASPAFSNILQPEFKPLNVSVVGSGSCGHIQFV
PVTKDGRVISEATPTLAAGKDPEKSSEDDVYLHTVIPAVVVAAILLVAGIIAMICYRKKR
KGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPET
TPLNQDTIGEYTPLRDEDPIAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgactgttggatgtgtcccgcagcccccgttcctggggaggactttgctcccagtgctg
ctgctcgcagcctcagctcgctgccactggcccagcgagccggcagaagtggtgcgggac
tgggaaaaccagctggaggcctccatgcactccgtgctctcggacctccgagagactgtg
ccggccgtggtggggataccagacagctccgccgtggtgggccgcttcttcagagtctcc
atccccacagatttaattgcttccaatggagaagcagtccaggtctccgaagctgggaag
gagtctttgccttcgtggttacactggaatgcggagagcagctccctggaagggctgccc
ctggacacggacaagggcgtccactacatctcggtgaccacgctgcagcccttccccaac
ggcagctatgtgccgcaggccgccaacgtcttctccgtggaggtgcaccaggaggaccac
agcgagccgcagtcgctgcgagcggcagcccaggaggcgggcgatgccgcgccgttcgtg
tgcggtgcggaggagccggtcaccatcctgaccgtcatcctggacgccgatttgacaaaa
atgacaccaaagcagaggatcgaacttttaaacagaatgaggagcttctcagaggtggag
cttcacaacatgaagttggttcctgttgtaaataacagactctttgacatgtcggccttc
atggctgggccgggaaacgcaaagaaggtggtggaaaacggggccttactctcgtggaaa
ctgggctgttctttgagccaaaacagcgtccccaacatcagcaaggttgaggccccggcg
aaagaagggactatgtctgcccgcctcggctaccctgtggtcggctggcacatcgctaac
aagaaacctcacctcccaaaaaggatgcgacggcagatcaacgccacccccacgcctctg
accgccatcggaccccccaccaccgccgctcaagagccaccgacgcggatcgtccccacc
ccgacgtcgcccgccatcgctccccccacggagacgacggccccgccggtcagggagccc
atcccgctgccgaggaagcctacggtcaccatcaggacgaggggccccatcgtgcagacg
cccacgctcgggccgatccagccaaccaggctggtggaaggcactgggacggtctccgtg
ccgattcgccccaccgtgcccggctacgtggagcccaccgcggtgatcacgccgcccacc
accaccaccaagaagcccagagtgtccactctgaagcctgccacgccgtccaccacggat
tcctccacggcgacgacacgcaggcccacccgcaggcccaagacgccccgtcccacgaag
cctcccagcaccacccgctccacgatctccaagctgaccaccgcctccccgcccacccgc
gtgcgcaccacggccagcggcgtcccccggccctgggagccaaacgagccgcccaagctg
acgaaccacatcgacagggtggacgcgtgggaggggacttacttcgaggtgaaaataccc
tcggatactttctacgacaaggaggataccaccactgacaagctgcagctgaccttgaag
ctgaaggagcagcaaatgatcgaggagaattcgtgggtccagttcaacagcaccagccag
ctcatgtacggcatgccggaccgcagccacgtggggaagcacgagtacttcatgtacgcc
accgacaaaggggggctgtttgccgtggacgcttttgaaatccacgtccacaaacgcccg
cacggggacaaatccccggtgaagttcaaggccaggctggaaggagaccacagcgcggtg
gcgaacgacatccataagaagatcatgctggtgaagaagctggccctggcgttcggcgat
aggaacagcagcaccatcacggtgcaggacatcgccaagggctccatcgtggtggaatgg
accaacaacaccctgcccctggagccctgcccccgcgagcagatccggactttgagcaaa
aagatcgcggaagactccgggggcgcgagcccggctttctccaacatcctgcagccggag
ttcaaacctctgaacgtgtcggtcgtgggctccgggagctgcgggcacatccagttcgtc
cccgtgacgaaggacggcagggtgatctcggaggcgacgccgacgctggcggctgggaag
gaccccgagaagagcagtgaggacgatgtgtaccttcacaccgtcatccccgccgtggtg
gtggccgccatcctgctggtggccggcatcatcgccatgatctgctaccgcaagaagagg
aaagggaagctgaccatcgaagaccaggccacgttcattaagaagggcgtgcccatcatc
ttcgccgacgagctggacgactccaagcccccgccgtcctccagcatgcccctcatcctg
caggaggagaaagccccgctgccccccccggagtaccccaaccagagcatgcccgagacc
acgccgctcaaccaggacaccatcggggagtacacgccgctgcgggacgaggaccccatc
gcgccgccctaccagccgcccccccccttcaccgctcccatggaggggaagggctcccgc
ccgaagaacatgaccccctaccgctccccgccgccctacgtccccccttaa

DBGET integrated database retrieval system