KEGG   Gallus gallus (chicken): 100049619
Entry
100049619         CDS       T01006                                 

Gene name
CFTR
Definition
(RefSeq) cystic fibrosis transmembrane conductance regulator
  KO
K05031  cystic fibrosis transmembrane conductance regulator [EC:5.6.1.6]
Organism
gga  Gallus gallus (chicken)
Pathway
gga02010  ABC transporters
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100049619 (CFTR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100049619 (CFTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    100049619 (CFTR)
Enzymes [BR:gga01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.6  channel-conductance-controlling ATPase
     100049619 (CFTR)
Transporters [BR:gga02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC7 subgroup
    100049619 (CFTR)
SSDB
Motif
Pfam: CFTR_R ABC_membrane ABC_tran AAA_21 AAA_29 T2SSE SMC_N AAA_16 RsgA_GTPase NACHT DUF87 NB-ARC NTPase_1 AAA_23 AAA_30 MeaB Intein_splicing
Other DBs
NCBI-GeneID: 100049619
NCBI-ProteinID: NP_001099136
CGNC: 7086
Ensembl: ENSGALG00000032986
UniProt: A0M8U4
Structure
PDB: 
6D3R 6D3S

Position
1
AA seq 1484 aa
MQRSPLEKANIFSKLFFRWTKPILKKGYRQRLELSDIYQIPSADSADNLSEKLEREWDRE
LATSKKKPKLINALRRCFFWKFMFYGILLYLGEVTKSVQPLLLGRIIASYDPDNSSERSI
AYYLGIGLCLLFLVRTLLIHPSIFGLHHIGMQIRIALFSLIYKKTLKLSSKVLDKISTGQ
LVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLLWDMLQASAFAGLAFLIVMAFFQAW
LGQMMMKYRDKRAGKINERLVITSEIIENIQSVKAYCWEDAMEKMIESLRETELKLTRKA
AYVRYFNSSAFFFSGFFVVFLAVVPYAVTKGIILRKIFTTISFCIVLRMTVTRQFPGSVQ
TWYDSIGAINKIQDFLLKEEYKALEYNLTTTGVEVDKVTAFWDEGIGELFVKAKQENNNS
KAPSNDNNLFFSNFPLHASPVLQDINFKIEKGELLAVSGSTGSGKTSLLMLIMGELEPSE
GKIKHSGRISFSPQVSWIMPGTIKENIIFGVSYDEYRYKSVIQACQLEEDILKFPDKDYT
VLGEGGIILSGGQRARISLARAVYKDADLYLMDSPFGYLDIFTEKEIFESCVCKLMANKT
RILVTSKLEHLKIADKILILHEGSCYFYGTFSELQGQRPDFSSELMGFDSFDQFSAERRN
SIITETLRRFSFEGESMGSRNEMKKQSFKQTSDFNDKRKNSIIINPLNAGRKLSIMQKNG
TQVNGLEDGHIDSPERRISLVPDLEQGDVGLPRSNMLNSDHMLQSRRRQSVLSLMTGTSV
NQGPHVSKKGSTSFRKMSVVPQTNLSSEIDIYTRRLSRDSILDITDEINEEDLKECFTDD
AESMGTVTTWNTYFRYITIHKSLIFVLILCVTIFLLEVAASLVLLLFLQKAAQINATQPE
NATSDNPPVIITDTSSYYMIYIYVGIADTLLAMGIFRGLPLVHTLITVSKTLHQKMVHAV
LYAPMSTFNSLKAGGILNRFSKDTAILDDLLPLTVFDLIQLILIVIGAITVVSILQPYIF
LASVPVIAAFIVLRAYFLHTSQQLKQLESEARSPIFTHLVTSLKGLWTLRAFGRQPYFET
LFHKALNLHTANWFLYLSTLRWFQMRIEMIFVVFFSAVAFISIITTGDGPGRVGIILTLA
MNIMGTLQWAVNSSIDVDSLMRSVSRIFKFIDMPTEEMKTIKPQKNNQFSDALIIENRHV
KDEKNWPSGGQMTVTDLTARYTEGGTAVLENISFSISSGQTVGLLGRTGSGKSTLLFAFL
RLLNTEGDIQIDGVSWNTVSLQQWRKAFGVIPQKVFIFSGTFRKNLDPYGQWNDEEIWKV
AEEVGLKSVIEQFPGQLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDP
ITSQVIRKTLKHAFADCTVVLSEHRLEAILECQRFLVIEDNKMRQYESIQKLLSEKSSLR
QAISHADRLKLLPAHRRNSSKRKPRPQICALQEETEEEVQETRL
NT seq 4455 nt   +upstreamnt  +downstreamnt
atgcagaggtcccccctggagaaggcgaacatcttctccaaacttttcttcagatggaca
aaaccaattttgaaaaagggttacagacaacgactggaactgtcggatatttatcagatt
ccttctgcggactctgcagacaatctttctgaaaaactagaaagagagtgggacagagag
ctggcaacttcaaagaaaaaacccaaactcattaatgctcttcgacgatgcttcttctgg
aaatttatgttctatggaatattactatatttaggggaggtcaccaaatctgtgcagccc
cttctgctgggaagaataatagcttcctatgacccagacaactcttctgaaagatccata
gcctactacctgggcattggcttgtgccttctcttccttgtgagaacgctgctcatacac
ccttctatatttggacttcatcatatagggatgcaaataagaatagctttgtttagcttg
atttataagaagaccttaaaactgtcaagcaaagttctagataaaataagtactggacaa
ttggtcagccttctttccaacaatctgaacaaattcgatgagggtcttgctctggctcac
tttgtgtggattgcacctttacaagtggcactactgatgggactgctctgggatatgtta
caagcttctgcattcgctggacttgcttttctaatagttatggcctttttccaagcctgg
ctgggacaaatgatgatgaaatacagggataagagggcagggaagatcaacgagaggctt
gtaatcacctcagaaataattgaaaatatacagtcagttaaagcctattgctgggaagat
gcaatggaaaaaatgattgaaagcctccgtgaaactgaactgaagctaacccgaaaagct
gcttacgtgagatatttcaacagctcggccttcttcttttcaggattttttgtggtgttt
ttagctgtggttccatatgctgtgactaaaggaattattctccgaaaaatatttaccact
atttccttttgcattgttcttcgaatgacagtgaccaggcagtttcctgggtctgtgcag
acctggtatgattctattggagcaataaacaaaatacaggatttcttgctaaaagaagaa
tataaggccctggagtataatctaacaacaactggggttgaggtggacaaagtaacagct
ttttgggatgagggaattggagagctctttgtaaaagcaaaacaggaaaacaacaacagc
aaagctcctagcaatgacaacaatctcttcttcagcaattttccccttcatgcttcacct
gtccttcaggatataaattttaagatcgagaaaggagagttattagctgtttctggatct
actggatcaggcaagacttctcttctgatgttgataatgggagaactggagccttctgag
ggtaaaattaaacacagtggaaggatatcattctctcctcaagtctcttggatcatgcct
ggaacaatcaaagaaaacatcatttttggtgtatcttatgatgaataccgatacaagagt
gtcatccaagcctgccaactggaagaggacattttgaagttcccagacaaagattataca
gtgctgggggaaggtggaatcattctgagtggaggccagcgagcacgaatctcactagcg
agagcagtgtacaaagatgctgatttgtatctcatggattctccttttggatatttagac
atttttacagaaaaagaaatatttgagagctgtgtgtgcaagttgatggccaataaaact
aggatcttagttacttcaaaactggaacatttgaagattgctgacaaaatattaatctta
catgaggggagctgctatttctatggaactttttctgaacttcagggtcaaaggccagac
ttcagctcagagctgatgggatttgattcttttgatcaattcagtgcagagagaagaaat
tcaattataactgagactctgcgacgattttcctttgaaggagaaagcatgggatcacga
aatgaaatgaagaagcagtcttttaaacaaacgtcagattttaatgacaaaaggaagaac
tccataattattaacccacttaatgcaggcaggaagttatcgataatgcagaagaatggg
acgcaggtcaatggactggaagatggccacattgactcaccagaaaggaggatctcactg
gtacctgacctggaacagggagatgtgggtctacctcgaagtaacatgttaaactctgac
catatgctgcaatctcggaggaggcagtctgtgttaagtctgatgacaggcacctctgtg
aaccagggtccacacgtctccaaaaagggaagtacatcatttaggaagatgtctgtggtg
cctcagacaaacctgtcttccgagatagatatctacactaggcgcttgtctcgagacagc
atcttggacataactgatgaaattaatgaagaggatttgaaggaatgctttactgatgat
gctgaaagcatgggtactgttaccacatggaatacttatttcagatacattaccatccac
aaaagcttgatttttgtactaattttatgtgtgactatcttcttacttgaggtggctgct
tctcttgttctgttattatttcttcaaaaagcggcacaaataaatgcgacacaaccagaa
aacgctaccagcgacaaccctccagtgatcatcaccgacaccagctcctactacatgatt
tatatttatgtgggaattgcagataccctgcttgccatgggaattttcagaggcttgccc
cttgtgcatacactgataacagtatctaaaactcttcatcaaaagatggtgcatgcagtt
ctttacgcaccgatgtcaacgttcaactctttgaaagcaggtggtatactcaacagattc
tctaaagatacagcgatactggatgatttacttccactgacagtatttgatctcattcag
ttaatactgattgtgattggcgctataacagtagtctcaatattacaaccctacatcttc
ctggcatcagtgcctgtgatagcagcctttattgtgttaagggcatacttcctccacact
tctcagcagctgaaacaactggaatctgaagctcggagtccaatattcacacatcttgtt
acaagcctaaaaggactgtggacgctgagagcttttgggcggcagccgtattttgaaacc
ctatttcacaaggctctgaacctacacacggcaaactggttcctctacctgtcaactctg
cgctggtttcagatgaggatagaaatgatttttgttgtctttttcagtgcagtggcattc
atctctatcataaccacaggtgatggaccaggtagagttggcattattcttactttagcc
atgaacatcatgggaaccttgcagtgggcagtaaactcaagcatagatgtggacagcttg
atgcggtctgtcagccgaatatttaaatttattgacatgccaacagaagagatgaaaacc
attaagccacagaagaataaccagttttcagatgcccttataattgaaaacaggcacgtg
aaagacgagaagaactggccatctgggggacagatgactgtgacggaccttacagccaga
tacactgaaggaggaactgctgtcttagaaaacatttccttttcaataagttcagggcag
acggtgggccttttaggaagaactggctcgggaaaaagcactttactttttgcattttta
agactgctgaatacagaaggggatattcagattgacggcgtctcctggaacacagtcagt
ttgcagcaatggagaaaggcctttggagtgattcctcagaaagtcttcatattttctgga
acttttcggaagaatttggatccttatgggcaatggaacgatgaagaaatatggaaagtt
gcagaggaggttgggctgaagtctgtgattgagcagttcccgggccagctggatttcgtt
cttgtggatggaggctgtgtcctcagccatgggcacaagcagttgatgtgccttgcccgg
tctgttctcagtaaggctaaaatcctgctgctggacgagcccagtgctcacctggacccc
ataacttcccaagtgatcaggaaaacgctgaagcacgcgtttgcagactgcactgtggtc
ctctctgagcacaggctggaagccatcctggagtgccagcggtttctggtgatcgaggac
aacaagatgcggcagtacgagtccattcagaagctgctgagcgagaagagctccctgcgg
caggccatcagccacgccgaccgcctcaagctgcttcccgcgcaccgccgcaactccagc
aagcgcaagcccaggccgcagatctgcgcgctgcaggaggagacggaggaggaggtgcag
gagacgcggctgtga

DBGET integrated database retrieval system