KEGG   Gallus gallus (chicken): 100125831
Entry
100125831         CDS       T01006                                 

Gene name
NSMCE3
Definition
(RefSeq) melanoma-associated antigen G1
  KO
K22823  non-structural maintenance of chromosomes element 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gga03400]
    100125831 (NSMCE3)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     100125831 (NSMCE3)
SSDB
Motif
Pfam: MAGE DUF3098
Other DBs
NCBI-GeneID: 100125831
NCBI-ProteinID: NP_001098534
CGNC: 59249
Ensembl: ENSGALG00000040480
UniProt: Q001T8
AA seq 246 aa
MSQRKRSRGSGLTQGDDEDFSVVPTQSPSQVQRNLESRSQEEINRKVTELVQFLLVKDQK
KIPIKRVDILKKVIREYKDVYSEIVNRAGRTLQQVFGLQMVEIDTKHHIYILTSTLPRVE
GENLKQDIQTAKLGLLIVILSFIFMKGNSAKDSAVWEFLRRLRVHPGEKHEVFGDVKKLV
MEEFVRQKYLEITPIPLTDPPEFNFQWGPRAAKETSKKDILSFVAKMQKKEPSFWISQYN
EAKANT
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtctcagaggaagcgcagcagaggctccggcctcacccagggcgacgatgaggatttc
agcgtggtccccacgcagagccccagccaagtgcagaggaacctggagagccgctcccag
gaggagatcaataggaaggtgaccgagctggtgcagttcttgcttgtgaaagaccagaag
aaaatccctattaaaagagtagacatcctgaaaaaagtcatccgtgaatacaaagatgtt
tactcagagattgtcaaccgggcaggcaggaccctgcagcaggtgttcgggttgcagatg
gtggagattgacaccaagcaccacatctacatcctcaccagcaccctgccccgtgtcgag
ggggagaacctgaaacaggatatacagacagccaagctgggcctcctcatcgtcatcctc
agcttcatcttcatgaagggcaactcagccaaagacagtgccgtatgggagttcctgcgc
cggctccgggtgcacccaggggagaagcacgaggtgtttggagacgtcaagaagctggtg
atggaggagttcgtgaggcagaagtacctggagatcacccccatccccctgacggacccc
cccgagttcaacttccagtgggggccgagggctgccaaggagacttccaagaaggacatc
ctgagctttgtggcaaagatgcagaagaaggagcccagcttctggatcagccaatacaac
gaggccaaagccaacacgtga

DBGET integrated database retrieval system