KEGG   Gallus gallus (chicken): 100170842
Entry
100170842         CDS       T01006                                 

Gene name
WNT11B
Definition
(RefSeq) protein Wnt-11 precursor
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100170842 (WNT11B)
   04150 mTOR signaling pathway
    100170842 (WNT11B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100170842 (WNT11B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    100170842 (WNT11B)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Morphogens
   100170842 (WNT11B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100170842
NCBI-ProteinID: NP_001124216
CGNC: 59253
Ensembl: ENSGALG00000004401
UniProt: B2ZUA3
Position
4
AA seq 351 aa
MGHLAVPTAAVLLYQLGLTTAIQWLALAENGSGVAWDKSHHCRLLAGLVPDQVQVCRRNL
EVMHSIVQAASETKSICQKTFAGMRWNCSSIQRAPSFGPDLLKGTRESAFVHALSAAAIA
HSIAQACASGSLPLCSCSSVPSEVPRLDFRWGGCGDNLHYGLQLGAAFADSPLKSNKLGL
QALRAVNWHNNVAGRQVLSESLDTKCKCHGVSGSCSVKTCWKALLSLGEIASELKSKYLA
AIRVSHRLVGHRKQLKPTETDIRVVRETDLVYLINSPDYCTPNVHLGSVGTQDRQCNKTS
AGSDGCNLLCCGRGYNAYMEEVVERCHCKYRWCCYVVCKRCRRLVERYVCK
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggccacctcgctgtgcccactgccgcagtgctgctgtaccagctggggctcaccacg
gccatccagtggctggcattggcagagaacggcagcggagtggcctgggacaaaagccac
cactgccggctgctggctgggctcgtgcccgaccaggtccaggtgtgccgcaggaacctg
gaggtcatgcacagcatcgttcaggctgccagcgagaccaagagcatctgccagaagacc
tttgcaggcatgaggtggaattgctcctccatccagcgtgcccccagctttggtcctgac
ctgctgaaaggcaccagggaatctgccttcgtccatgcgctttctgctgctgccattgca
cactctattgcccaagcctgtgcttcagggtcactcccgctctgctcctgcagctccgtc
ccctccgaggtccccaggctggacttcagatggggtggctgcggggacaacctgcactat
ggcctccagctcggtgctgcttttgctgacagccccctaaaatctaacaagctgggattg
caggctctcagggccgtgaattggcataacaacgtggcgggcaggcaggtgctgagtgag
tccctggataccaagtgcaaatgccacggtgtttcaggctcctgttcggtgaagacctgt
tggaaggcactgctgagtctgggtgaaattgcctccgagctcaaatccaagtacctggca
gccatcagggtgagccaccgcctcgtggggcacaggaagcagctgaagcccacagaaacg
gacatcagggtggtgagagagacggacctggtttatctgatcaactcccccgactactgc
acgcccaatgtccacctggggtctgtggggacacaggataggcagtgcaacaagacgtct
gcgggcagcgatggctgcaacctgctgtgctgtggccgtggctacaacgcttacatggag
gaggtggtggagaggtgtcactgcaagtaccgctggtgctgctacgtggtgtgcaagagg
tgccggcggctggtggagaggtacgtctgtaagtag

DBGET integrated database retrieval system