KEGG   Gallus gallus (chicken): 100316920Help
Entry
100316920         CDS       T01006                                 

Gene name
OSR1
Definition
(RefSeq) protein odd-skipped-related 1
  KO
K09215  odd-skipped
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100316920 (OSR1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100316920 (OSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 C1_4 XPA_N zf-AN1 GAGA zf-met CpXC FYVE
Motif
Other DBs
NCBI-GeneID: 100316920
NCBI-ProteinID: NP_001162180
CGNC: 60883
UniProt: A0A3Q3ATU9
Position
3
AA seq 260 aa AA seqDB search
MGSKTLPAPVPIHPSLQLTNYSFLQAFNGLPAVPSDHLSNLYGFSALHAVHLHQWTLGYP
AMHLPRSSFSKVPSVSSLVDARFQLPTFPLFPHVIQPKQEAANMTLKAKPRFDFANLAVA
ATQEDHSKLGQVDSQGSPPGLGSLLEVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTK
SYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTL
AVHKTLHTQVKELKPAKLKC
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtaagactctgccggccccagtgcctatccatccttccctccagcttaccaac
tactccttcttgcaagcattcaacgggctgcctgctgtgccttctgaccacctttccaac
ctctatggcttcagcgccctgcacgccgtacacctgcaccagtggactttggggtacccg
gccatgcatctgccccgttcctccttctccaaagtgcccagcgtgtcgagcctggtggat
gcacggttccagctgcccaccttcccactcttcccacatgtcatccagcccaagcaagag
gctgctaacatgaccctcaaagccaaaccccgctttgattttgccaacctcgcagtggct
gccacgcaagaggaccactctaaattgggacaggtggacagccagggctccccgccaggg
ctggggtctttgcttgaggtgactaaactctctccagagaagaaacccacccggggaagg
ttaccatccaaaaccaagaaggagtttgtgtgtaaattctgtggcaggcacttcaccaag
tcgtacaaccttttgatccatgaaagaacccacactgatgaacggccctacacatgcgac
atatgccacaaggccttcagaagacaggatcacctgagagaccacagatatatccattct
aaagaaaagccttttaagtgtcaagaatgtgggaaaggattttgccagtccagaactcta
gctgtccacaagacactgcacacgcaagtaaaggaactgaaacctgccaaacttaagtgc
tga

DBGET integrated database retrieval system