KEGG   Gallus gallus (chicken): 100857108
Entry
100857108         CDS       T01006                                 

Gene name
CHD5
Definition
(RefSeq) chromodomain-helicase-DNA-binding protein 5 isoform X5
  KO
K14435  chromodomain-helicase-DNA-binding protein 5 [EC:3.6.4.12]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    100857108 (CHD5)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100857108 (CHD5)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    100857108 (CHD5)
SSDB
Motif
Pfam: CHDCT2 SNF2_N DUF1086 CHDNT DUF1087 PHD Helicase_C Chromo ResIII HDA2-3 PHD_2
Other DBs
NCBI-GeneID: 100857108
NCBI-ProteinID: XP_015152532
CGNC: 66059
Ensembl: ENSGALG00000000747
Position
21
AA seq 1980 aa
MRGPAAGEELLEEADNDEDVSGAEEDDGVLEGLEEFFAEEQVAVQKKKKSKKLKDGKVAK
IKRRKKEGSNDEISDNDEEIEEKSESEGSDYSPNKKKKKKLKEKKEKKTKRKKKDEEEDD
DDGGLKEPKSSAQLMEEWGLDDVDYIFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIPMSK
MMTVLGAKWREFSANNPFKGSSAAAAAAAVAAAVETVTVAPQLPASPQQPALPPVIRKAK
TKEGKGPGVKKKIKSSKDGKKKGKGKKMAGLKFRFGGIPSKRKKGSSSEEEEREESDFDS
ASINSSSVRSECSAGLGKRGKRRRKKKRIEEGDGYETDHQDYCEVCQQGGEIILCDTCPR
AYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKEEEDEEEEGGEEEEDDHMEFCRVCKD
GGELLCCDTCPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWAWKEPPAPL
PSALPAPDAELALPLPKVLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQR
KNDMDEPPAFDYGSGDEDSQREKRKNKDPHYAKMEERFYRYGIKPEWMMIHRILNHSFDK
KGDIHYLIKWKDLPYDQCTWEIDEIDIPYYENLKLLYWNHRELMLGEDTRPLKKLNKKGK
KLKEEKLEKPPETPLVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILA
DEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDK
ESRSVIRENEFSFEDNAIRSGKKVFRMKKEAQIKFHVLLTSYELITIDQAVLGSIEWACL
VVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGF
LEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFIL
TRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNSLVKSSG
KLMLLQKMLKKLRDGGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAID
RFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVM
IYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDD
VEGMVSQGQRLTMPDAVTPFSDTLSTKGGAVTPGMKKKHGGTPPGDNKDVDDSSVIHYDD
AAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREIIKQEENVDPDY
WEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDE
DEDFEERPEGGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGM
PPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVL
TRIGVMSLVRKKVQEFEHVNGKYSTPDMILEGPESKKCSEMVSSDPNTPVPASPAHTHAG
PLALAEKADPPLGFQEEKDQVEQKSRRASDSQVPGSTEKVESEEYQENCESKEKLKEEKQ
EESEKAEPSPEPLGKDEGIQEKEKALEKPESNSSPGKGEDKEVKPAEDTKVEEKEQSETQ
QNGDKEEEDGKKDDRNVNFRFMFNIADGGFTELHTLWQNEERAAISSSKIYDIWHRRHDY
WLLAGIVTHGYARWQDIQNDPRYVILNEPFKSEIHKGNYLEMKNKFLARRFKLLEQALVI
EEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKGLL
WFLPDLQQQLWTEFPRSWARWDCQLQPDASGTLRDRYLALSKTFFCCSHSHLSSPWATLQ
PREEAAGSPRDGDAVGRGGHSPTPLVPTCASTHVTPTIARPSPKGISFPCTFFCTFLLKT
NT seq 5943 nt   +upstreamnt  +downstreamnt
atgcggggcccggcggccggcgaggagctgctggaggaggcggacaacgacgaggacgtg
tcaggtgccgaagaagatgatggggtgctggaaggactggaggagttttttgcagaggag
caagttgctgtgcagaagaaaaagaaatccaagaagctgaaagatggcaaggtggccaaa
atcaagaggaggaagaaagaggggagcaatgatgagatatcagacaatgatgaggagatt
gaggagaaatctgagagtgaaggaagtgactattcccccaacaagaagaaaaagaaaaaa
ctgaaggaaaagaaggagaaaaaaaccaaacggaaaaagaaggatgaagaggaggatgat
gatgatggagggctaaaggagcctaagagctcagcccagctgatggaagaatggggcctt
gatgatgtagattacattttctcagaagaagattaccatactcttactaattacaaggca
ttcagccaatttctcaggcctctgattgccaagaagaaccccaagatccccatgtccaag
atgatgacagtgcttggtgccaagtggcgagagttcagtgccaacaacccattcaagggc
agctcggcggcggcagcagcggcagccgtggctgcagcagtggagactgtcacagttgcg
ccacagctgcctgccagcccccagcagcctgccttgccccctgtcatcaggaaagcaaaa
accaaggaaggcaagggtccaggtgtgaagaagaaaatcaagagctcaaaagatgggaag
aaaaaggggaagggaaaaaagatggcaggcctaaaattccggtttggaggaatccccagc
aaaaggaaaaagggctcctctagtgaagaggaagagcgggaggaatccgactttgacagt
gccagcatcaacagctcctccgtgcgctccgagtgctcggctggcctggggaagagaggg
aagaggaggagaaagaaaaagaggattgaagaaggtgatggctacgagacggaccaccag
gactactgcgaggtgtgccagcagggaggggagatcatcctgtgtgacacctgtccgcgt
gcctaccacctcgtctgcctggaccctgagctggagaaagcccctgagggcaagtggagc
tgcccacactgtgagaaggagggcatccagtgggagccaaaggaggaggaggatgaggag
gaggaaggtggtgaagaagaggaggatgaccacatggagttctgccgtgtctgtaaggat
ggaggggagctgctgtgctgcgacacgtgcccgtcctcttaccacctgcactgcctgaac
ccacccctgccagaaatcccaaatggtgaatggctctgccctcgctgtacatgccctcct
ttgaagggaaaagtacaacgcatcctgcactgggcgtggaaggagcctccggccccgctg
ccctctgcactgcctgccccagatgcggagctggctctgccgctgccaaaggtgttggag
ggcatcccagagcgcgagttctttgtcaagtgggcagggctctcctactggcactgttcc
tgggtcaaggagctacagttggagctctaccacaccgtgatgtaccgcaactaccaaagg
aagaacgacatggatgagccaccagcctttgactatggctctggagatgaggacagccag
agggagaaaaggaagaacaaagacccgcactacgcaaagatggaggagcggttctaccgc
tatggcatcaagcctgagtggatgatgatccaccgcatcctgaaccacagctttgataaa
aagggagacatccattatctgatcaaatggaaagatctgccatatgaccagtgtacctgg
gagatcgatgagatagacatcccatactatgaaaacctcaagctcctctactggaatcac
agggagctgatgctgggggaggacacacgtcctctgaagaagctgaacaagaaggggaaa
aagctgaaagaggagaagctagaaaagcctccagaaactcctcttgttgatcctacggtg
aagtttgacaagcagccttggtacattgatgccacaggaggcacactgcatccttaccag
ctggaagggctcaactggttgagattttcctgggcccaaggcactgatacgatcctggct
gatgaaatgggactggggaagactgtgcagaccattgtgttcttgtattcgctgtacaag
gagggccactccaaagggccttacctggtcagtgccccactctccaccatcatcaactgg
gagcgtgagtttgagatgtgggcaccagacttctatgtcgtgacctacactggggacaag
gagagccggtcggtcatccgggaaaatgagttctcttttgaagacaatgccatccggagt
ggcaagaaggtgttccggatgaagaaggaagcccaaatcaagttccatgtcctgctcacc
tcctatgagctgatcaccatagaccaggcggtgctgggttccatcgagtgggcttgtctg
gtggtggatgaagcacacagactgaagaacaaccagtccaaattctttagggtgttaaac
agttacaagatcgattacaagttgctgcttactgggactccgctccagaacaacctggaa
gagctcttccacctgctcaatttcttgactcctgagaggtttaataacctggagggcttc
ctggaggagtttgcagacatctccaaggaggaccagatcaaaaagctccatgacctgctg
ggcccccacatgttgcgccggctcaaggcagatgtgttcaagaacatgccggccaagacg
gagctgattgtcagagtggagctgagtcagatgcagaagaagtactacaagttcatacta
acacggaattttgaagccctgaactcaaaaggtggagggaatcaggtctcactgcttaac
atcatgatggatctgaagaagtgctgtaatcacccatacctcttccctgtggctgctgtg
gaggccccagttctgcccaatggatcctatgatgggaattctttggtcaaatcttctgga
aaactgatgctgctccaaaagatgctgaagaagttacgggatgggggtcacagagttctg
atcttctctcagatgacgaagatgttggacttgctggaggacttcctggagtacgagggc
tacaagtacgagcgcatcgatgggggcatcactggaggcctacgccaggaagccattgat
aggtttaatgctcctggtgctcagcagttctgctttctcctctctacccgtgctggtggt
ctgggcataaaccttgctacggctgacacagtcattatttatgattctgactggaatccc
cacaatgacatccaggcattcagcagagcacaccgcatcgggcagaacaagaaggtgatg
atctaccgctttgtgaccagagcctctgtggaagagcgcatcacccaggtggccaaaagg
aagatgatgctcacccacctggtggtccgccctgggcttggctccaagtcaggctccatg
accaagcaagagctggatgacatcctgaagtttgggacagaagagctcttcaaggatgat
gtggaaggcatggtgtctcagggacagcggctcaccatgccggatgctgtcacccctttc
tctgacacgctgtccaccaaagggggtgcagtgactcctggcatgaaaaaaaagcatggt
ggcaccccaccaggtgacaataaggacgtggatgacagcagtgtgatccactatgacgat
gctgctatctctaagcttctggaccgaaaccaggatgcgactgatgacacagagctgcag
aacatgaacgagtatctcagctcctttaaagtggcccagtatgttgtgagagaagaggat
ggtgtggaggaggtggaacgtgagatcatcaaacaagaggagaatgtggaccctgactac
tgggagaagctgctgcggcaccactatgagcagcagcaggaagatctggccaggaacttg
gggaaggggaagagaatccgcaagcaggtcaattacaatgatgcctctcaggaggatcaa
gagtggcaggacgagctctctgacaaccagtctgagtactccattggctctgaggatgaa
gatgaagactttgaagaaagaccagaaggtggcagaagacaatcacggagacagctgaag
agtgaccgggacaaacctctccctcctttgctggcaagagttggggggaatattgaggtt
ctcgggttcaatgcccgccaacgcaaggccttcctgaacgctatcatgcggtggggcatg
ccgccccaggacgccttcaactctcactggctggtgagggatctgcgggggaagagcgag
aaagagttcagggcttacgtctccctgttcatgcgacatttgtgtgaacctggagcagat
ggtgccgaaacctttgcagatggtgttccccgggaggggctgtcacgccagcacgtgctg
actcggattggagttatgtcactagtaaggaagaaggtgcaggagtttgagcatgtcaat
gggaaatacagcaccccagatatgattctggaaggcccagagagcaagaagtgcagtgag
atggtttcttcagatcccaacacccctgtcccagccagcccggcgcacacacatgcagga
cctcttgcccttgcagaaaaagcagacccaccacttggattccaggaggaaaaggaccaa
gtggagcagaagtccaggagagcatctgacagccaggtgcctggaagcactgagaaggta
gaaagtgaggagtaccaagaaaactgtgaaagcaaagagaaactgaaggaagagaaacaa
gaagagagtgaaaaagctgagccttctcccgagcccctggggaaagatgagggaattcaa
gaaaaagagaaggctttggaaaagccagagtcaaacagcagccctggtaaaggggaggac
aaagaagtcaagccagcagaggataccaaggtggaagagaaggagcaaagtgagactcag
caaaatggggacaaagaagaggaggacggaaagaaggacgacagaaatgtgaactttaga
ttcatgttcaacattgccgatggaggctttacagagctgcacacgctgtggcagaatgag
gaaagagctgccatctcctccagcaagatctatgacatctggcaccgcagacacgactac
tggctgctggcagggattgtcacccacggctatgcccgctggcaggacatccagaacgac
ccgcgctacgtgatcctgaacgagcccttcaagtcagagatacacaaagggaactacctt
gagatgaagaacaagttcctcgcccggcgcttcaagctgctggagcaagccctggtgata
gaggagcagctgcggcgggcggcgtacctcaacatgactcaagaccccaatcacccggcc
atggcattgaacgcccgtctggctgaagtggagtgccttgctgaaagccaccagcatctc
tccaaagagtccctcgctgggaacaagcccgccaatgccgtcctgcacaaggggctcctt
tggttcctcccagatctacaacaacagctttggaccgaatttccgaggtcctgggccagg
tgggattgtcaactacagccagatgcctctgggaccctacgtgacagatatttagccctt
tctaagactttcttctgctgttcccattcccacctgagcagcccctgggccactctccag
ccccgagaagaagctgcagggtcaccaagggatggggatgcagtgggcagaggaggacac
agccccacacccctcgtccccacatgcgcttcaactcatgtgaccccgaccatcgccaga
ccttctccgaaggggatttcatttccttgtacatttttttgcactttcttattgaagact
tga

DBGET integrated database retrieval system