KEGG   Gallus gallus (chicken): 100857422
Entry
100857422         CDS       T01006                                 

Symbol
POU3F4
Name
(RefSeq) POU domain, class 3, transcription factor 4
  KO
K09365  POU domain transcription factor, class 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100857422 (POU3F4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    100857422 (POU3F4)
SSDB
Motif
Pfam: Pou Homeodomain Homeobox_KN HTH_31
Other DBs
NCBI-GeneID: 100857422
NCBI-ProteinID: XP_003641125
CGNC: 65597
Position
4:complement(9060787..9064716)
AA seq 363 aa
MATAASNPYGLLGSGSLAHADGAGMQQGSPFRNPQKLLQSEYLQGVPGNGHPLGHHWVTS
LSDAAPWPSALAGGPLEQPDVKPGREDLQLGALLHHRSPHVSHHSPHANHPGAWGASPAH
GGSLGPAGQPPPLGVYPQAGFAVGGVLEHGGLTPPPAAAAQQPPPPQGLHPGEHGELGGH
HCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEAL
QLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFL
KCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGEQQQHEVYAHGVKTDSAC
HDL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggccacagccgcctccaacccctacggcctgctcggctccggctcgctcgcccatgcg
gacggcgcgggcatgcagcaggggagcccgttccgcaacccgcagaaactgctgcagagc
gagtacctgcagggcgtccccggcaatgggcacccgctgggccaccactgggtgacgagc
ctgagcgacgccgcgccctggccctcggcgctggcgggcggccctctggagcagcccgac
gtgaagccgggccgcgaggacctgcagctgggcgcgctgctgcaccaccgctcgccccac
gtctcgcaccactcgccccacgccaaccaccccggcgcctggggggccagcccggcgcac
ggcggctcgctgggccccgccgggcagccccccccgctcggcgtgtacccgcaggccggc
ttcgcggtgggcggcgtgctggagcacggggggctgacgccgccgcccgccgccgccgcg
cagcagccgccgccgccgcaggggctgcaccccggggagcacggcgagctgggcggccac
cactgccaggaccactcggacgaggagacgccgacctcggacgagctggagcagttcgcc
aagcagttcaagcagcgccgcatcaagctgggcttcacccaggccgacgtgggcttggcg
ctggggacgctctacggcaacgtcttctcgcagaccaccatctgccgcttcgaggccctg
cagctcagcttcaagaacatgtgcaagctgaagccgctgctgaacaagtggctggaggag
gccgactcctccaccggcagccccaccagcatcgacaagatcgcggcgcagggcaggaag
aggaagaagcgcacctccatcgaggtgagtgtcaaaggcgtgctggagacgcacttcctc
aagtgccccaagccggccgcgcaggagatctcctcgctggcggacagcctgcagctggag
aaggaggtggtgcgggtctggttctgcaaccggcggcagaaggagaagcgcatgacgccg
ccgggcgagcagcagcagcacgaggtgtacgcgcacggcgtcaaaacggactcggcctgc
cacgacctctga

DBGET integrated database retrieval system