KEGG   Gallus gallus (chicken): 100857623
Entry
100857623         CDS       T01006                                 

Gene name
POU4F1
Definition
(RefSeq) POU domain, class 4, transcription factor 1
  KO
K09366  POU domain transcription factor, class 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100857623 (POU4F1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    100857623 (POU4F1)
SSDB
Motif
Pfam: Pou Homeodomain HTH_31 Homeobox_KN
Other DBs
NCBI-GeneID: 100857623
NCBI-ProteinID: XP_015132813
CGNC: 65408
Ensembl: ENSGALG00000035441
UniProt: A0A1D5P1G4
Position
1
AA seq 389 aa
MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEA
LAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHHQALEPGDLLEH
ITSPSLALMPGGAGGGGGGGGHDGAGGGGGGGGGGGGGGGGGGGGGGLISSSAHPHPHMH
GLGHLSHPAAMNMPSGLPHPGLVAAHHGAAGQVASAAAVVGAAGLASICDSDTDPRELEA
FAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQ
AWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAE
KLDLKKNVVRVWFCNQRQKQKRMKFSATY
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgatgtcgatgaacagcaagcagccgcattttgccatgcatcccaccctacctgagcac
aagtacccctcgctgcactccagctcggaggcgatccggagagcgtgtctgccaacgccg
ccgctgcagagcaacctcttcgccagcctcgatgagacgctgctggctcgggccgaagct
ttggccgccgtcgacatcgccgtgtcgcagggcaagagccaccccttcaagccggacgcc
acataccacaccatgaacagcgtcccctgcacctccacctccaccgtgcccctggcgcac
caccaccaccaccaccaccaccaccaccaggcgctggagcccggcgacctcctggagcac
atcacctcgccctccctggcgctcatgcccggcggcgccggcggaggaggcggcggcggc
ggccacgacggggcgggcggcggaggcggcgggggaggcggcggagggggcggcggcgga
gggggcggcggaggcggcggcctcatctccagctcggcgcacccgcacccgcacatgcac
ggcctgggccacctctcgcacccggccgccatgaacatgccgtcggggctgccgcacccg
gggctggtggccgcgcaccacggcgcggcggggcaggtggcctcggcggcggccgtggtg
ggggcggcggggctggcctccatctgcgactcggacacggacccgcgggagctggaggcc
ttcgccgagcgcttcaagcagcgccgcatcaagctgggggtgacccaggccgacgtgggc
tcggcgctggccaacctgaagatcccgggcgtgggctcgctcagccagagcaccatctgc
cgcttcgagtcgctgacgctgtcgcacaacaacatgatcgccctcaagcccatcctgcag
gcctggctggaggaggccgagggggcccagcgggaaaaaatgaacaagcccgagctcttc
aacgggggcgagaagaaacgcaagcggacttccatcgccgccccggagaagcgctccctg
gaggcgtacttcgccgtccagccccggccctcctccgagaagatcgctgccatcgccgag
aaattggacctcaaaaagaacgtggtgcgggtttggttttgcaaccagagacagaagcag
aaacggatgaaattttccgccacctattag

DBGET integrated database retrieval system