KEGG   Gallus gallus (chicken): 100857753Help
Entry
100857753         CDS       T01006                                 

Gene name
ABHD12B
Definition
(RefSeq) protein ABHD12B isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gga01002]
    100857753 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    100857753 (ABHD12B)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100857753 (ABHD12B)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100857753 (ABHD12B)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100857753 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Cutinase Lipase_3 Peptidase_S15 Say1_Mug180 VirJ LIDHydrolase PGAP1 DUF676
Motif
Other DBs
NCBI-GeneID: 100857753
NCBI-ProteinID: XP_003641499
CGNC: 66118
Ensembl: ENSGALG00000020342
UniProt: F1NMM5
Position
5
AA seq 359 aa AA seqDB search
MRRRGGAEAAGRGDGDGSGKAAEQSAERPRRGWLGWCPRLHTVLLQLLLIYISVPFLIRL
FPVILTKFVFLNFLAFPFFADLRQPALLLNNTISLYLPTEPGVTVGIWHTVPGSSGNEAR
GREQRWFEEALADAHPIIIYLHGNGGTRAARHRIQFMKLMGAAGFHILALDYRGYGDSSG
QPSESGFTTDVLALYDWAKARSGNSSIIFWGHSLGTGIATNAARKLQEERGVQVDAVVLE
SPYTNIRDAAANIPITKIYRQFPGFEYLILDSMALGNMFFRNDENVKVLACPLLILHAED
DTVLPPRLGRQLFETARRAYKDKSKVKFITFPGKLGLGHDYISSNPELPTLVKDFLNMK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgacgcggcggcgcggaggctgcgggacgtggggacggcgatggcagcgggaag
gcggcggagcagagcgcggagcggccccggcggggctggctgggctggtgcccccgactg
cacaccgtcctcctgcagctgctccttatctacatctccgtgcccttcctcatccgcctc
ttccctgtcatcctcaccaaatttgtcttcctaaacttcctggccttccctttctttgcg
gacctgcggcagccggcgctgctgctcaacaacaccatcagcctctacctgcccaccgag
ccgggcgtcaccgttggcatctggcacacggtgccgggcagcagtgggaatgaggcgcga
ggtcgggagcagcgctggttcgaggaggctctggctgatgctcaccccatcatcatctac
ctgcacggtaacgggggcaccagggctgcacgccaccggatccagttcatgaagctgatg
ggggctgccggcttccacatcctggccctggactacagaggctatggggactccagtgga
caaccctcggagagcggcttcaccactgacgtcctggcgctgtacgactgggccaaagca
cgcagtgggaacagctccatcatcttttggggacactccctggggaccgggatcgcgaca
aacgcggccagaaagctgcaggaggagcgaggggtccaggtggacgccgttgtgctggag
tccccctacaccaacatccgcgacgcagccgccaacatccccatcactaagatttatcgg
cagttcccaggtttcgagtacctcatcttggactccatggctctgggcaacatgttcttc
cgcaacgatgagaatgtgaaggtgctggcctgcccgctgctcatcctgcacgcagaggat
gacaccgtgctgcccccgcggctgggacgccagctcttcgagaccgcacgcagagcctac
aaggacaagagcaaggtgaagttcatcaccttccccgggaagctggggctgggccacgac
tacatctcctccaacccagagctgcccaccctggtgaaagacttcttgaacatgaagtga

DBGET integrated database retrieval system