KEGG   Gallus gallus (chicken): 100858027
Entry
100858027         CDS       T01006                                 

Gene name
LLGL1
Definition
(RefSeq) lethal(2) giant larvae protein homolog 1 isoform X1
  KO
K06094  lethal(2) giant larvae protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100858027 (LLGL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    100858027 (LLGL1)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100858027 (LLGL1)
SSDB
Motif
Pfam: LLGL WD40 Lgl_C
Other DBs
NCBI-GeneID: 100858027
NCBI-ProteinID: XP_015149903
CGNC: 66072
Ensembl: ENSGALG00000014408
Position
14
AA seq 1204 aa
MSGLEVPPPPLGPTLKRKKKMRKNEGGKKKKKGRNLLAAVKGCGRANYNSQHPLRRRMRS
AERRAPLRRACGRALIGGTRCPSGPHPAPPRRCLPGARRAALGARSGGGAPAPGPAPDRH
RDRERHRRQRERLPRDHRPRPPPPGTEPSPAGPTMMKFRFRRQGAEPHRERLRHDLFAFS
KTVEHGFPSQPSALAYDPRLRVMAIGTKAGAVKLYGAPGVELTGLHKETATVTQLHFLAG
QGWLLSLLDDNSLHLWEIYQKEGCSHLEETRSFGLPARPGCSPSITRVTVILPTSPGAVT
CLGTEGGAVYFLALPALVLLEDKTLFQDEILQSVPDDYRCGKALGPVESIQEHPQDAGRL
LIGYSRGLVALWDQSTRTVQHLFLGNQQLESLAWEHSGKNIVSSHSDGSYMVWAVGGSGQ
RTQQPVMATIPYGPFPCKAISKILWQTCESGNPFIIFSGGMPRASYGDRHCVSVLQGQSL
ATLDFTSRVIDFFTVQDPEVPEGGFENPRALVVLVEEELVVIDLQTPGWPTIPAPYLAPL
HSSAITCSYHISNVPLKLWERIVSAGEQQSPRLSSAAWPINGGKNLAQEPTQRGLLLTGH
EDGTVRFWDASGVSLKPLYKLGTANIFQTDCEHNDSLNQAGEEEWPPFRKVGCFDPYSDD
PRLGIQKIALCKYTAKMVVAGTAGQVLVMELSDDKSEHAVSVATVDLLQDREGFTWKGHD
RLAPRNGPIAFTPGFQPSVLVQCVPPAAVTAVTLHSEWNLVAFGTSHGFGLFDYHRRNPV
LARCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRLNAGSPSSKVQEANA
QLAEQAGPPEVEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDAAHHGPTMWAGTNSG
SVFAYALEVPSQEKFSERAVEAVLGKEIQLMHRAPVVAIAVLDGRGNPLPEPYEVSRDLA
KAPDMQGSHSMLISSEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALVSLASTGAEERV
ENCLACLTNLGDIHIFTVPALRPQVHYSCIRKEDISGIASCVFTKHGQGFYLISPSEFER
FSLSARNVTEPLCCLEVSRLQDTSCLSNSMATPKVQQANGTHVPHSPEANHSPADSDRSP
EERQATFSPGSVDSPNSSMENPLDTTGDITVEEVKDFLASSEEVERNMRNASEDEVRPAG
ILIK
NT seq 3615 nt   +upstreamnt  +downstreamnt
atgagcggcctggaggtgcccccgccgcccctcggcccaaccctgaagagaaaaaaaaaa
atgcgaaagaatgagggaggaaaaaaaaaaaaaaaagggagaaacctattggctgccgtg
aagggctgcgggagagcgaactacaactcccagcaccccctgcgccggcgcatgcgcagc
gcagaaaggagggcgccgctgcgccgtgcgtgcggacgcgcgctgattggcgggacgcgc
tgtccgtcagggccacaccccgccccgccgcggcggtgcctgcccggggctcggcgcgcg
gcgctcggcgctcggagcggggggggggcgcccgcaccgggaccggcaccggaccggcac
cgcgaccgggagcggcaccgccggcagcgggagcgtctgccccgggatcaccggccccgc
ccgccgcctcccggtaccgaaccgagccccgccggccccaccatgatgaagtttcggttc
cggcggcagggcgccgagccgcaccgcgagcggctccgccacgacctcttcgccttcagc
aagacggtggagcatggcttccccagccagcccagcgccctggcctacgacccccggctg
cgcgtgatggccatcggcaccaaggcaggagctgtcaagctgtacggtgcgcccggcgtg
gagctgaccggtttgcacaaggagacggccactgtcacccagctgcacttcctggccggg
cagggctggctgctgtccctgctggatgacaactcgctgcacctctgggagatctaccag
aaggagggctgctcccacctggaggagacgcgcagcttcgggctgccagcacgccccggc
tgctcccccagcatcacacgggtgacggtgatccttcccacgtccccgggtgccgtgacc
tgcctgggcacggagggcggagcggtgtacttccttgcactgcctgccctcgtgctgctg
gaggacaaaaccctcttccaggatgagatcctacaaagcgtgcccgatgattaccgctgt
gggaaggcactggggccagtggagtccatccaggagcacccccaggatgctgggaggctg
ctgattgggtacagccgggggctggtggccctgtgggaccagagcacgcgcaccgtgcag
cacctcttcctcgggaaccagcagctggagagcctggcctgggagcacagcgggaagaac
atcgtcagctcacacagtgatggcagctacatggtgtgggcagtgggcggcagcgggcag
cgcacccagcagcccgtcatggccaccatcccctacggtccgttcccctgcaaagccatc
agcaaaatcctgtggcagacgtgtgagtcgggcaaccccttcatcatcttcagcggtggc
atgccgcgggccagctacggcgaccggcactgcgtcagtgtgctgcagggacagagcctc
gccacgctggacttcacctctcgtgtcatcgacttcttcacagtgcaggaccctgaggtg
ccagagggaggctttgagaacccccgtgccctggtggtgctggtggaggaggagctggtg
gtgatcgacctgcagacgccgggctggcccaccatccccgccccatacctggccccgctc
cactcctccgccatcacctgctcctaccacatctccaacgtgcccctcaagctctgggag
aggattgtcagtgccggggagcagcagagcccgcgcctctcctctgcagcctggcccatc
aatggagggaagaacctggcccaggagcccactcagaggggtctgctcctcaccgggcac
gaggacggcaccgtgcggttctgggacgcctcgggggtatccctgaagccgctgtacaag
ctgggcaccgccaacatcttccagaccgactgtgagcacaatgacagcctcaaccaggca
ggcgaggaggagtggccgccgttccgcaaggtgggctgctttgatccctacagtgatgac
ccccgtctgggcatccagaagattgctctgtgcaaatacacagccaagatggtggtggcc
ggcacagcggggcaggtgctggtgatggagctgagtgatgacaagtctgagcatgctgtc
agtgtggccacggtggatctgctgcaggaccgcgagggcttcacctggaagggccacgac
cgcctggcaccccggaacggccccatcgccttcacccccggcttccagcccagcgtcctg
gtgcagtgcgtgccccccgccgctgtcaccgccgtcaccctgcactccgagtggaacctg
gtggcttttggcaccagccacggcttcgggctctttgattaccaccggcgcaacccggtg
ctggccaggtgtacgctgcaccccaatgactcgctggccatggaggggcccctgtcccgt
gtcaagtccctcaagaagtccctgcggcagtccttccgccgcatccgcaagagcagggtg
tcaggcaagaagaggctgaacgccggcagcccctccagcaaggtgcaggaggccaacgcg
cagctggctgagcaggcgggcccccccgaggtggagatgacaccggtgcagaggcgcatc
gagccccgctcggctgacgattcgctgtccggggtggtgcggtgcctttacttcgccgac
accttcctccgagatgccgcccaccacggccccacgatgtgggcagggaccaactcgggc
tcagtgttcgcctacgccctggaggtgccgtcacaggagaagttttcggagcgggcggtg
gaggcggtgctggggaaggagatccagctgatgcaccgtgcgcccgtggtggccatcgcc
gtgctggacgggcgggggaacccactgccagagccctacgaggtgtcacgggacctggcc
aaggctcctgacatgcagggcagccactccatgctcatctcctcagaggagcagttcaag
gtcttcacgctgcccaaagtcagcgccaagaccaagttcaagctgactgcgcatgagggc
tgccgggtgcggaaggtggccctggtcagcctggccagcactggcgccgaggagcgcgtg
gagaactgcctggcctgcctcaccaacctgggcgacatccacatcttcaccgtgcccgcc
ctgcggccgcaggtgcactacagctgcatccgcaaggaggacatcagcggcatcgcctcc
tgcgtcttcaccaagcacgggcagggtttctacttgatttcaccgtccgagtttgagcgc
ttctccttaagcgccaggaatgtgacggagccgctgtgctgcctggaggtgtcccggctg
caggacacctcgtgcctcagcaactcgatggcgacgccgaaggtgcagcaagccaatggc
acgcacgtcccgcacagccccgaggccaaccattcccctgctgacagcgaccggtccccc
gaggagcgccaggccaccttctcgcccggctccgttgactcgcccaacagcagcatggag
aacccgctggacaccaccggggacatcacggtggaagaagtgaaggatttcctggcatcc
tcagaggaggtggaaaggaacatgaggaacgccagtgaggacgaggtgcgacctgcgggc
atcctcatcaagtga

DBGET integrated database retrieval system