KEGG   Gallus gallus (chicken): 100858057
Entry
100858057         CDS       T01006                                 

Gene name
HSDL2
Definition
(RefSeq) hydroxysteroid dehydrogenase-like protein 2
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: adh_short adh_short_C2 SCP2 Alkyl_sulf_C KR
Other DBs
NCBI-GeneID: 100858057
NCBI-ProteinID: XP_003643140
CGNC: 66125
Ensembl: ENSGALG00000015663
UniProt: E1C7S2
Position
Z
AA seq 413 aa
MLPNTGKLAGCTLFITGASRGIGKAIALKAARDGANIVIAAKTAEPHPKLPGTIYTAAEE
IEAAGGRALPCIVNVRQEEQIISAVEKAVKTFGGIDILVNNASAISLTGTLETETKKVNL
MMDVNVRGTYLTSKACLPYLRKSKNPHILNLSPPMNMKPIWFKNHCAYTISKYGMSMCVL
GMAEEFKGEVAVNALWPKTAIHTAAMDMLGGSGIEKQCRKTDIIADAAYCILTKPKSFTG
NFIIDEVLLREEGVKDFDVYAIAPGHPLMPDFFLDAETDMTESHGASQASDGAKANKESA
PAGPVAETFRLIQGELNKEMVKSTQGVFQFELSGDEGGTWYLDLKTSSGSAGFGKPPAAA
DVVMSMSSGDFVKMFTGKLKPTMAFMSGKLRIKGNMALAVKLEKMLTQFNAKL
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgctgcccaacactgggaaactagcaggctgcacgctcttcatcactggtgcaagccgg
ggaattggcaaagccattgctctgaaggctgccagggatggtgcaaacattgtgatcgcc
gccaagacagcagaaccccatcctaaacttcccgggactatctacacagctgcagaagag
attgaagcagctggaggaagggcattgccatgcattgttaatgtgaggcaagaagagcaa
attattagcgccgtggagaaagctgtgaagacgtttggagggattgatattttggtgaac
aatgcaagcgccatctctttgactggcactttggaaacagaaaccaagaaggtcaatctt
atgatggatgtcaacgtacgaggaacctacctcacgtctaaagcgtgccttccctactta
cggaagagtaagaacccccatatcctgaacctcagcccgcctatgaatatgaaacccata
tggttcaaaaatcactgtgcctacacgatttctaaatatggcatgtccatgtgtgtcttg
ggaatggcagaagaatttaaaggagaagttgctgtcaatgctttatggcctaaaacagcc
atacatacagctgctatggatatgctgggaggatccggaatagagaagcagtgcagaaaa
actgacatcattgcagatgctgcatattgcattttaacaaagccaaaaagcttcactgga
aacttcattattgatgaagttctactgagagaagaaggcgttaaggattttgatgtctat
gcaattgcaccaggtcaccccctgatgcctgacttcttcttggatgctgaaactgacatg
acagaaagccatggtgcttcacaggcatcagatggagccaaggctaataaagaatctgct
ccagctgggcctgttgcagaaacattcagacttatccagggagaactcaataaagaaatg
gtgaaatccacccagggcgtctttcagtttgaactgtcaggtgatgaaggaggcacttgg
taccttgatctgaaaaccagcagcgggagcgccgggtttgggaagcctcctgcagcagct
gacgttgtgatgagcatgtcgagcggcgactttgtgaagatgttcactggtaaactaaag
ccaaccatggccttcatgtcaggaaaattaaggattaaaggtaacatggcactagcagta
aagctagagaagatgctgacacagtttaacgctaaactgtga

DBGET integrated database retrieval system