KEGG   Gallus gallus (chicken): 100858067
Entry
100858067         CDS       T01006                                 

Gene name
KCNA6
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 6
  KO
K04879  potassium voltage-gated channel Shaker-related subfamily A member 6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    100858067 (KCNA6)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    100858067 (KCNA6)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100858067 (KCNA6)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100858067 (KCNA6)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Other DBs
NCBI-GeneID: 100858067
NCBI-ProteinID: XP_003643199
CGNC: 65004
UniProt: A0A1D5PP83
Position
1
AA seq 613 aa
MPTVTWINQARSPLSCSPSRVCARARRGRQSRCTVLSTSAPAPGPRIGPGQKEAPRGEPP
GRRRAGEAQQAGLWAARRRRADDGRRCPLKEKWGCRQSGGMRAEEPLALAAPQAGGGEAE
ATGEEQGGSGCCSSERLVINISGLRFETQLRTLSIFPDTLLGDPSRRVHYFDPLRNEYFF
DRNRPSFDAILYYYQSGGRLRRPVHVPLDIFLEEIRFYQLGQEAIETFREDEGFIQEEEK
PLPEHHFQRQVWLLFEYPESSGPARAIAIVSVLVILISIVIFCLETLPEFRQEPKVTQPG
FGELAVLDDDILLPPPPPSGTPQPPQPTAGAGPFFTDPFFLIETLCIIWFSFELLVRFFT
CPSKPDFSRNIMNIIDIVAIIPYFITLGTELAQQQQQQSGSSSNNGGQQQAMSLAILRVI
RLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPDS
LFTSIPDAFWWAVVSMTTVGYGDMYPMTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYF
YHRETDNEEQCQYTHVTCGQQQSLFSEPKKGNSNQSLSKSEFFEVEDLESMKYSNFIPPG
NQGYKEKKMLTEV
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgccaactgtgacatggatcaaccaagctcgtagtcccctgtcttgctctccttcccgt
gtgtgtgcgcgcgcgcggcggggaaggcagagccgctgcacggtgctgagcacgtcggcg
ccagcaccaggaccgagaataggaccgggacagaaggaggcgccgcggggcgagccgccg
ggcaggcgcagagcgggagaggcgcaacaggcggggctgtgggcggctcggcggcggcgt
gcggatgacgggcggcgctgccctctgaaggagaagtgggggtgcaggcagagcggcggc
atgcgggcagaggagccgctggcgctggcggccccgcaggcgggcggtggcgaggcagag
gcgacgggcgaggagcagggcggcagcggctgctgcagcagcgaacggctagtgatcaac
atctctgggctgcgcttcgagacgcagctgcggaccctctccatcttccccgatacgctg
ctaggcgacccaagccgccgggtgcactacttcgaccctctccgcaacgagtacttcttc
gaccgcaaccgacccagcttcgacgccatcctttattactaccagtctggagggcggctc
cggcggccagtccacgtgccccttgacatcttcctggaggagatccgtttctaccagctg
ggccaggaggctattgagaccttccgtgaggatgaaggtttcattcaggaggaggagaag
cccctgcctgagcaccacttccagcgccaagtctggctgctctttgagtaccctgagagc
tccggaccagcccgtgccattgccatcgtctctgtgctggtgatcctcatctccattgtc
atcttctgcctagagaccctgcctgagtttcgccaggagcccaaggttacccagcctggc
tttggggagctagctgtgcttgatgatgacatactgctgccaccaccaccaccaagtggg
accccgcagcctccacaacccactgctggtgctggccctttcttcactgacccatttttc
ctcatcgagacactgtgcatcatctggttctcctttgagcttcttgtgcgtttcttcact
tgccccagcaagcctgacttctctcgcaacattatgaatatcattgacattgtggcaatc
atcccctacttcatcaccctgggcacagagctggcccagcagcagcagcagcagtctggg
agtagcagcaacaatggtggccagcagcaagctatgtccttggccatcctcagagtcatc
cgattggtgagggtcttcaggatcttcaagctctccaggcactccaaagggctacaaatc
ttggggaagactctccaggcaagcatgagggagctaggtctcctcatcttcttcctcttt
attggggtgatcctcttttctagtgccgtatactttgcagagactgatgaccctgactca
ttgttcaccagcattcctgatgctttttggtgggcagtggtgtccatgaccaccgtgggc
tatggggacatgtatcccatgacaattggtggcaagattgtgggttccttgtgtgccatt
gcgggtgtgctcaccattgctctgcctgtgcctgtcattgtgtccaacttcaactacttt
taccaccgagagactgataatgaagagcagtgccaatacacccatgtcacctgtggccag
cagcagtcactcttctctgagcccaagaaggggaacagtaatcagtctctcagcaaatct
gaatttttcgaagtggaagacctggagtccatgaaatattccaacttcattccccctggt
aatcagggttataaagagaagaaaatgctgacagaagtgtga

DBGET integrated database retrieval system