KEGG   Gallus gallus (chicken): 100858174
Entry
100858174         CDS       T01006                                 

Gene name
NEUROG3
Definition
(RefSeq) neurogenin-3
  KO
K08028  neurogenin 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100858174 (NEUROG3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    100858174 (NEUROG3)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 100858174
NCBI-ProteinID: XP_003641519
CGNC: 64904
Position
6
AA seq 288 aa
MAPQSDRAPAAGQPYLGGPDAAASPAAGGSAGAGSRGASPARSALPPREVARRKGLGKAR
RGLGKARGEGPLSKQKRSRRMKANDRERNRMHHLNSALDALRSVLPTFPDDAKLTKIETL
RFAHNYIWALTQSLLLAEQGLPEPPPPPPPAAVAAAASPGPWGSPYPGLPPGAVLGTSPG
CSAPDAEYPRLSGPGASQAFPGGLSLTQGAELGAAPQSRWEKEQRPRSGPGRRGSRESSP
ALSSRDSICSWRFTAGRPPRSVLPSGMVVARQSALRGRKPIVMLIVLS
NT seq 867 nt   +upstreamnt  +downstreamnt
atggccccgcagagcgaccgcgccccggccgccgggcaaccctacttaggcggccccgac
gccgccgcatccccggccgcgggcggctccgcgggcgcgggcagccggggtgcgtcgccc
gcccgcagcgcgctacccccgcgggaggtggcccgcaggaaggggctggggaaggcgcgg
cgcggccttgggaaggcgcgtggcgaggggccgctcagcaagcagaagcgaagccggcgc
atgaaagccaacgaccgggagaggaaccgcatgcaccacctcaactccgccctggacgcg
ctccgcagcgtccttcccaccttccccgacgacgccaagctcaccaagatcgagaccctc
cgcttcgcgcacaactacatctgggcgctcacgcagagcctgctcttggccgagcagggt
ttgcccgagcctcccccgccgccgccccctgccgccgtcgccgccgccgcctcccccggg
ccctggggctcgccctatcccggtttgcctcccggggcagttttgggcacgtccccgggg
tgcagcgctcccgacgccgagtacccgcggctgagcggccccggcgcgagccaggccttc
ccaggagggctcagcctcacgcagggcgccgagctcggggcagctccgcagagccggtgg
gaaaaggaacagcgcccacgcagcggccccgggaggaggggatcccgcgagtcctccccg
gccctctcctcccgcgactcaatttgtagctggagatttacggccgggcgccctccccgc
tcggtgctccccagcgggatggtcgtcgctagacaaagcgccctgcgaggccgaaagccc
attgtgatgctaattgttctcagctga

DBGET integrated database retrieval system