KEGG   Gallus gallus (chicken): 100858302
Entry
100858302         CDS       T01006                                 

Gene name
KRT75L4
Definition
(RefSeq) keratin, type II cytoskeletal 6B-like
  KO
K07605  type II keratin, basic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    100858302 (KRT75L4)
   04147 Exosome [BR:gga04147]
    100858302 (KRT75L4)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     100858302 (KRT75L4)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100858302 (KRT75L4)
  Exosomal proteins of other body fluids (saliva and urine)
   100858302 (KRT75L4)
  Exosomal proteins of colorectal cancer cells
   100858302 (KRT75L4)
  Exosomal proteins of bladder cancer cells
   100858302 (KRT75L4)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 ATG16
Other DBs
NCBI-GeneID: 100858302
NCBI-ProteinID: XP_015155859
CGNC: 64777
Ensembl: ENSGALG00000043689 ENSGALG00000044875
Position
33
AA seq 616 aa
MSRQCYTSSSLLGRRGFSSASAVCGLGRAGSSSASVCQPAARRCGLGGFSSRSVCDLGRG
QRISFGGSCRSAAYGAGSVGRCGTAYGGGRFGVGTVVGFGNCGGYGGLGGYRGLGDGVAM
GGYSGGISIGLGGGRSEGIRGVSIHPELLKPLCVGVDPEECQVRTHEKEQIKNLNNQFAC
FIDKVRLLEQQNKVLTTKWELLQQYVLPASRRNLEPVFENFICNLRKQLECVLGERERLE
NEERCLRDLVQEYKCKYEDEINKRTAAENEFVVLKKDVDCLYLTKEELEVRVGLLRQQLE
FLKCIYAEERAQMDCQLCDTSVIVQMDNSRDLDMEGIIKSVECCYEEIAQKSKAEVEAFY
QTRLEELHSSRGKFCDDLRNNQSEIAELNRMIQKLQCESDNVKKQIAALQTAICDAEQRG
DCALKDARQKLVDLQTALQQAKDKMACLLRDYQELLNVKLALDIEIATYRTLLEGEESRI
CTGNPVSVAVVSGGGTVGECRSLSGIGGKCSVKTGASSGLGGVVSSFGVSGAGFSARSVD
CVPRVGGGFGARSAASCVGREVLSGADGLQCAAGVGNLVCAGVEQCSPGTVIIPGPGVCG
GGNRYSTAVRVVRTSR
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgagccggcagtgctacacctccagctcgctgctgggccgacgtggcttctcctcagcc
tccgccgtctgcggtctgggcagggcaggcagcagctcagcctcggtgtgccaaccggcg
gcacggcgctgcgggttgggtggcttcagcagccggagtgtctgcgacctgggccgtggg
cagaggatttccttcggaggaagctgccgtagcgcggcgtatggcgcaggcagcgtggga
cgatgcggcactgcctatggtggaggtcgcttcggcgtgggcacggtggtggggttcggt
aactgcggaggctatgggggcctgggcggctacagaggccttggggatggcgtggcgatg
ggtggctacagcggaggcatcagcatcgggcttggaggaggtcgatcggaagggatccgc
ggtgtcagcatccacccagagctcctcaagcccctgtgcgtgggagtggaccctgaggag
tgccaggtgcggacccacgagaaggagcagatcaagaacctcaacaaccagttcgcctgc
ttcatcgacaaggtccgactgctggagcagcagaacaaggtgctgaccaccaaatgggag
ctgctgcagcagtacgtcctgccggcatcccggcgcaacctggagcctgtctttgagaat
ttcatctgcaacctgaggaagcagctggagtgcgtgctgggggagcgagagaggctggag
aatgaggagcgttgcctgcgggacctggtgcaggaatacaagtgcaagtatgaagatgag
atcaacaagcgcacggcagcggagaatgagttcgtggtgctgaagaaggacgtggactgc
ctttacctgaccaaggaagagctggaggtgcgggtgggcctcctgcggcagcagctggag
ttcctcaagtgcatctacgctgaggagagagcacagatggactgccagctgtgtgacact
tcagtcattgtgcaaatggacaacagccgggacctggacatggagggcattatcaaaagt
gtggagtgctgctacgaggagattgcccagaagagcaaggctgaagttgaggctttctac
cagaccagactggaagagctccacagcagccggggcaagttctgtgatgacctacggaac
aaccagagtgagatagctgagctgaaccggatgatccagaagctgcagtgtgaatcagat
aacgtgaagaaacagattgcagccctgcagacggccatctgcgatgctgagcaacgtggt
gactgcgccctcaaagatgcacggcagaagctggtggacctgcagacagctctgcagcag
gccaaggacaagatggcatgtctactgagggactaccaggagctgctgaatgtcaagctg
gccctggacattgagattgcgacttacaggactctgctggaaggagaagagagcaggata
tgcactggcaacccggtgagcgtagccgtggtcagtggtggtggcacggtcggtgagtgc
cgatccctatccggaatcggtggcaaatgctctgtgaagactggagccagctcggggctg
ggaggggtggtctcatcctttggggtcagcggtgctggattcagtgctcgcagcgtggac
tgcgtccccagggtggggggtggctttggagcccggagtgcagccagctgcgtggggcgc
gaggtgctgtctggtgctgatgggttgcaatgtgcagccggagtgggcaacctggtgtgt
gctggagtggagcagtgcagccccgggactgtcatcatcccagggccgggggtgtgtgga
gggggcaaccggtacagcacggctgtgcgcgtggtcagaacaagccggtag

DBGET integrated database retrieval system