KEGG   Gallus gallus (chicken): 100858397
Entry
100858397         CDS       T01006                                 

Gene name
CNOT1
Definition
(RefSeq) CCR4-NOT transcription complex subunit 1
  KO
K12604  CCR4-NOT transcription complex subunit 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100858397 (CNOT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    100858397 (CNOT1)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     100858397 (CNOT1)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     100858397 (CNOT1)
SSDB
Motif
Pfam: Not1 CNOT1_CAF1_bind CNOT1_TTP_bind DUF3819 CNOT1_HEAT
Other DBs
NCBI-GeneID: 100858397
NCBI-ProteinID: NP_001264062
CGNC: 64685
Ensembl: ENSGALG00000002301
UniProt: E1C1B8
Position
11
AA seq 2376 aa
MNLDSLSLALSQISYLVDNLTKKNYRASQQEIQHIVNRHGPEADRHLLRCLFSHVDFSGD
GKSSGKDFHQTQFLIQECASLITKPNFISTLSYAIDNPLHYQKSLKPSPHLFAQLSKVIK
LSKVQEVIFGLALLNSFSSDLRGFAAQFIKQKLPDLLRSYIDADVSGNQEGGFQDIAIEV
LHLLLSHLLFGQKGAFGVGQEQIDAFLKTLRRDFPQERCPVVLAPLLYPEKRDILMDRIL
PDSGGIAKTMMESSLADFMQEVGYGFCTSIEECRNIIMQFGVREVTAAQVARVLGMMART
HSGLTDGIPLQSISAPGSGIWSDGKDKSDGAQAHTWNVEVLIDVLKELNPSLDFKVVTYE
LDHPGFQIRDSKGLHIVVFGIQRGLGMEVFPVNAIYRPWKHAEGQLSFIQHSLINPDIFC
FADYPCHAVTTDILKAPPEDDNREIATWKSLDLIESLLRLAEVGQYEQVKQLFSFPIKHC
PDMLVLALLQINTSWHTLRHELISTLMPIFLGNHPNSAIILHYAWHGQGQSPSIRQLIMH
AMAEWYMRGEQYDQAKLSRILDVAQDLKALSMLLNGTPFAFVIDLAALASRREYLKLDKW
LTDKIREHGEPFIQACMTFLKRRCPSILGGLAPEKDQPKSAQLPPETLATMLACLQACAG
SVSQELSETILTMVANCSNVMNKARQPPPGVMPKGRPPSASSLDAISPVQIDSLAGMASL
SLGGSAAPHTQSMQGFPPNLGSAFSTPQSPAKAFPPLSTQNQTTGFSGIGGLSSQLPVGG
LTTGSLTGIGTGALGLPAVNNDPFVQRKLSTSGLSQPTFQQSKMKPSDLSQVWPEANQNF
SKEIDDEANSYFQRIYNHPPHPTMSVDEVLEMLQRFKDSNIKREREVFNCMLRNLFEEYR
FFPQYPDKELHITACLFGGIIEKGLVTYMALGLALRYVLEALRKPFASKMYYFGIAALDR
FKNRLKDYPQYCQHLASISHFIQFPHHLQEYIEYGQQSRDPPVKMQGSITTPGSIALAQA
QAQAQVPAKAPLAGQVSTIVTTSTTTTVAKTITITRPTGVSFKKDVPPSINTTNIDTLLV
ATDQTERIVEPPENVQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVS
IEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLG
MITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSVRSVVFRPPNPWTM
AIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGSLLKDKDRLKNLDEQLSAPK
KDVKQPEELPPITTTTASTTPATSTTCTATVPPQPQYSYHDINVYSLGGLAPHITLNPTI
PLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRVA
AHHMMRNLTAGMAMITCREPLLMSIATNLKNSFATALRAASPQQRDMMEQAAAQLAQDNC
ELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRYCDPVVLTYQAERMPEQIRLK
VGGVDPKQLAVYEEFARNVPGFLPTNDLTQPTGFLAQPMKQAWATDDVAQIYDKCMTELE
QHLQSIPHTLAMNPQAQALRSLLEAVVVARNSRDAIAALGLLQKAVEGLLDATSGADADL
LLRYRECHLLVLKALQDGRAYGSPWCNKQITRCLIECRDEYKYNVEAVELLIRNHLVNMQ
QYDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHSRG
NAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWV
NLYHSAAAGRDSTKAFSAFVGQMHQQGILKTDDLITRFFRLCTEMCVEISYRAQAEQQHN
PAANPTMIRAKCYHNLDAFVRLIALLVKHSGEATNTVTKINLLNKVLGIVVGVLLQDHEV
RQGEFQQLPYHRIFIMLLLELNAPEHVLETINFQTLTAFCNTFHILRPTKAPGFVYAWLE
LISHRIFIARMLAHTPQQKGWPMYAQLLIDLFKYLAPFLRNVELTKPMQILYKGTLRVLL
VLLHDFPEFLCDYHYGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDMLSEINI
APRILTNFTGVMPPQFKKDLDSYLKTRSPVTFLSDLRSNLQVSNEPGNRYNIQLINALVL
YVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSH
THYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNH
EFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGAS
NT seq 7131 nt   +upstreamnt  +downstreamnt
atgaatcttgactcgctctcgctggccttgtctcaaatcagctacctggtggacaattta
accaagaaaaactaccgagccagccagcaagaaatacagcacattgtgaataggcacggt
cccgaggcagacaggcatttactacgctgtctattctcgcacgtggatttcagtggcgat
ggtaaaagcagtggcaaagatttccatcagactcaatttctgatccaggagtgtgcgtcg
ctgattacaaaaccaaactttatctcgacgctgtcctacgccattgacaatccattgcac
tatcagaagagtctaaagccttcaccccatttatttgcccaattgagtaaagtcatcaaa
ttaagtaaagttcaagaggtgatatttggtctcgctttactgaactctttcagctcagat
ctacgaggttttgctgcccagtttatcaaacagaaactcccagatcttttacgctcttac
attgacgcggacgtcagtggaaatcaagaaggtggcttccaagatattgcaatagaggtc
ctgcaccttctcctctcccatctcctttttgggcagaagggagcctttggggtgggacag
gaacagattgacgctttcctcaaaacattacgtagagattttccccaggagcgttgccct
gtggtgcttgcaccacttctataccctgaaaaacgggacattctaatggacaggatcctg
cctgattctggagggatagccaaaacaatgatggagagttctctggcagactttatgcaa
gaagttggctatggcttttgtacaagcattgaagaatgtcgcaacataatcatgcagttt
ggagtccgggaggtgacggctgcccaggttgccagggttctggggatgatggctcgaacg
cattcggggttgacggatggtattccattacaatctatttcggctcctggcagtggaatt
tggagcgatgggaaagataaaagtgatggagcacaagcccatacctggaatgtggaggtc
ctaattgatgttcttaaagagctgaatcctagcctggatttcaaagtagtaacgtatgaa
ttggaccacccaggatttcagattcgtgacagcaaaggcctgcatattgtggtgtttggc
atccagagagggctaggcatggaagtttttccagttaatgccatatacagaccttggaag
catgcagagggccagctctccttcattcaacattccctcataaacccggacatcttttgt
tttgctgactacccttgtcatgctgttaccacagacatcctgaaagcaccaccagaggat
gacaatcgagaaattgctacatggaagagcctggatttgatcgaatctctgttacggttg
gcagaagtgggacagtatgagcaggttaagcagctcttcagttttcccatcaagcattgc
ccagatatgttggtattggccttattgcagatcaacacttcctggcataccttgcgccat
gaactcatctccacgctcatgccaatcttccttggcaaccatcccaattctgccatcatt
ttgcactatgcatggcatgggcagggtcagtctccttcgattcgccagcttatcatgcat
gcaatggcagaatggtacatgagaggggagcagtatgaccaggcaaaattgtcacgtatt
cttgatgtggcgcaagacttgaaggccttgtcaatgctgctaaatggtactccgtttgcc
tttgttattgaccttgctgcacttgcctctcgacgagaatacctcaaacttgacaaatgg
ctcacagacaaaattcgggagcatggggagcccttcatccaggcctgcatgaccttctta
aagagaagatgtccatctatcctaggtggccttgctccagaaaaagatcaacccaaaagt
gctcagcttcctccagaaaccttggcaactatgttggcatgcctgcaggcttgtgctggg
agtgtttctcaggagctgtcggagaccatcctcaccatggtagccaactgcagtaatgtc
atgaacaaggccagacagccaccacctggagtcatgcccaaaggccgcccgcccagcgcg
agcagcctggatgccatctctcctgtgcagattgactcgcttgcaggaatggcatctctg
agtttaggtggctcggctgctcctcacacccagagcatgcaaggcttccctccaaacttg
ggctctgcgttcagtactcctcagtcaccagcaaaagcgtttccccctctttccacccaa
aaccagacaacaggtttcagtggcattggaggactctcttcacagcttccagtaggtggt
cttactacgggtagcctgactggcataggaactggagccctgggccttcctgcagtgaac
aatgacccattcgtgcaaaggaagctgagcacatctggactgagccagcctacgttccag
cagagtaagatgaaaccttctgacttatctcaggtgtggccagaggctaatcagaacttt
agcaaagaaatagatgatgaggcaaacagctacttccagcgtatctataaccatccacca
catccaaccatgtctgtagatgaggtcttggaaatgctgcagaggtttaaggactccaat
attaaacgggaacgagaagtgtttaactgtatgctgaggaacttgtttgaggaataccgt
ttctttccccagtacccagacaaagagctgcacataacagcctgcctctttggtgggata
atagagaaaggactggttacttacatggctttgggcctggcccttcgctacgttcttgaa
gccttacgaaagccttttgcgtccaaaatgtactattttggtattgctgcactagataga
tttaaaaatagattgaaggactatccccagtattgtcagcacttggcttctattagtcac
tttatacagttccctcatcacttgcaggagtacatagaatacggacagcagtctagagat
cctcctgtgaaaatgcagggttcaatcaccacccctggaagtattgcacttgcccaggct
caggcccaggcccaggttccagcaaaggctcctcttgctggccaagtcagcactatagta
accacctcaaccaccaccactgttgcaaaaaccatcacgatcactcgaccaactggagtc
agcttcaagaaagatgtgccgccttccattaatactaccaacattgatacactgttagta
gcaacggatcaaactgagagaattgtggaacctccagagaacgtccaggaaaaaattgct
ttcatcttcaataatctgtctcagtcaaacatgacacagaaggttgaagaactgaaggaa
acagtgaaagaagagttcatgccttgggtatcgcagtatctcgtgatgaagagagtcagc
attgagccaaattttcacagcttatattcaaacttccttgacacccttaagaatccagag
tttaataaaatggttctgaatgaaacttacagaaatatcaaggtgctactgacatcagat
aaggctgcagccaacttctccgaccgttccttgttaaagaaccttggtcactggctggga
atgattaccctggctaaaaataaacccatcttgcacacggatttggatgtgaagtcacta
ctactggaagcgtatgtgaagggacagcaggaattgctttatgtagtaccatttgttgcc
aaagtcttagaatccagtgtcaggagtgtggtcttcaggcctccaaacccatggacaatg
gccattatgaatgttttagctgagctgcatcaagaacatgatctaaaattgaatctgaag
tttgagattgaagtgctctgcaagaatcttgcactggacatcaatgagctgaaacctgga
agtctcctgaaagataaggatcgtctgaaaaatctggatgagcagctgtctgctccaaag
aaggatgtgaagcagccagaagagctaccacccatcacaacaaccaccgcttctacaact
ccagctaccagcaccacttgtacagccacagttcctccacagccccagtacagttatcat
gacatcaatgtctattcattaggaggactggctccacacattaccttaaatccaacgatc
ccgctgtttcaggcccacccccagctgaagcagtgtgtgcggcaggctatagagcgagcg
gtgcaggagctcgtccatcccgtggtcgatcggtccattaagattgccatgactacttgt
gagcagatagtcaggaaggactttgcactggattcggaggagtcacgaatgcgtgtggct
gcacaccatatgatgcggaacttgactgctgggatggccatgatcacctgcagggaacct
ttgctcatgagcatagctaccaacttgaagaacagttttgctactgcgctgagggcagcc
tccccacaacagagggacatgatggagcaagcagctgcccagctggcgcaggataactgt
gagctggcgtgctgctttatccagaagacagctgtggaaaaagcaggccctgaaatggac
aagaggctggcgactgaatttgagctcagaaaacatgctagacaagagggtcgtcggtac
tgtgatcctgttgtgttaacttaccaagctgaacggatgccagaacagatcaggttaaag
gttggaggtgtggacccaaaacagctggctgtttacgaagagttcgcacgtaacgtcccc
ggcttcttgcctaccaatgacttaactcagcctacaggattcttggctcaacctatgaag
caagcttgggccacagatgatgtagcacaaatctatgacaaatgcatgacagaactggag
cagcacctacagtccattccccatactctggccatgaatcctcaagctcaagcattacgc
agcctcctggaggctgtggtggtcgctcggaactcccgtgatgccatcgctgcgcttgga
ctgctgcagaaggctgtagagggcttactggatgccaccagtggggcagatgctgacctt
ctgcttcgctatcgtgagtgtcacctgctggtgctgaaggctctgcaggacggccgtgcg
tatggatctccgtggtgtaacaagcagattaccaggtgcctgattgagtgtagagatgag
tacaagtacaacgtggaagctgtggagctgctaatccgcaatcacctggttaacatgcag
cagtatgatcttcacctggcacagtcaatggagaacggcttgaactatatggctgtggca
tttgccatgcagttggtaaagatccttcttgtggatgagagaagtgttgcccatgtaaca
gaggcagatctgttccacaccatcgagacgctcatgaggattaatgctcattccagaggg
aatgccccagaagggttaccccagttgatggaagtggtccgatcaaactacgaagcaatg
attgaccgtgctcacggaggtcccaatttcatgatgcattctggaatttcccaagcctct
gagtatgatgatccaccaggtctgagggagaaggcagaatacctgctgagggagtgggtc
aacctctaccattctgctgcagcgggccgcgacagtaccaaagcgttctctgcgtttgtt
ggacagatgcaccagcaagggatcctgaaaacagatgacctgatcacccgctttttccgg
ctttgcactgaaatgtgtgttgaaatcagctatcgtgctcaggctgagcaacagcacaac
cctgctgccaaccccacgatgatccgggccaagtgctaccacaatctggatgcctttgtg
cggcttattgcactgcttgtgaagcactctggagaagcaaccaacaccgttacgaagatc
aacctcctgaacaaggttcttggtattgtggtgggagttcttctgcaagaccatgaagtt
cggcagggtgagtttcagcagcttccttaccatcgcatcttcatcatgttgctgttggaa
ttaaatgctcctgagcatgtgttggagaccatcaacttccagacgctcacagctttctgt
aacacatttcacatcctgaggcctacaaaagctccaggttttgtttatgcctggctggaa
ctgatctcccatcggatatttattgcaagaatgctggcacatacaccacagcagaagggt
tggcctatgtatgcccagttactgatcgatcttttcaagtacttggctccttttctcaga
aatgtggaactcaccaaacctatgcaaattctttacaagggcactctgcgtgtgttgctg
gtcttgttgcatgatttcccagaatttctttgtgactaccattatgggttctgcgatgtc
atcccacctaactgtattcagttaaggaatttgatcctgagtgccttcccacggaacatg
aggcttccagaccctttcacccccaatctgaaggtggacatgttgagtgaaattaatatt
gctccacgaattctcaccaatttcacgggagtgatgccacctcagttcaagaaagacttg
gattcctatctcaaaacccgatctccagtcacttttttgtctgacttgcgcagcaactta
caagtatcaaatgaacctggcaaccgctacaacatccagctgattaatgccctggtgctc
tacgtaggtactcaggctattgcgcacatccacaacaaaggcagcacaccctccatgagc
accattacccactcagcacacatggacatcttccagaatttggcagtggacctggacacc
gaaggtcggtacctcttcctgaatgcaattgccaatcagctgcgataccccaacagtcat
acccactacttcagctgcaccatgctttacctgtttgcagaggccaacactgaggctatc
caggagcagatcacaagggttctcttggaacgactgattgtaaataggcctcatccctgg
ggtctcctcattactttcatcgagctgataaaaaacccagcatttaagttctggaaccat
gaatttgttcactgcgctccagaaattgagaagttgttccagtcggttgcacagtgctgc
atggggcagaagcaagcccagcaagtaatggaggggactggtgccagttag

DBGET integrated database retrieval system