KEGG   Gallus gallus (chicken): 100858404
Entry
100858404         CDS       T01006                                 

Symbol
HOXA5
Name
(RefSeq) homeobox protein Hox-A5
  KO
K09305  homeobox protein HoxA/B/C5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100858404 (HOXA5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    100858404 (HOXA5)
SSDB
Motif
Pfam: Homeodomain DUF2209 Homeobox_KN DUF739
Other DBs
NCBI-GeneID: 100858404
NCBI-ProteinID: NP_001305348
CGNC: 66000
Ensembl: ENSGALG00000025929
UniProt: Q6B3N0
Position
2:complement(32622230..32624987)
AA seq 270 aa
MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQYRDSASMHSGRYGYGYNGMDLSVGRSA
STHFGASERARTYPANSTSASTEPRYSQSAAASHSPPPDPLPCTAVAASPVSESHHGVKN
SLGNSSSTSSNSSSSTHISRDGVGTSSGTEEDTPASSEQASAPSDQSTAQPSQPQIYPWM
RKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK
IWFQNRRMKWKKDNKLKSMSMAAAGGAFRP
NT seq 813 nt   +upstreamnt  +downstreamnt
atgagctcttattttgtaaactcattttgcggtcgctatccaaatggcccggactaccag
ttacataattatggagatcacagctcggtgagcgagcaatacagggactccgccagcatg
cactccggcaggtacggatacggctacaatggcatggacctcagcgtcgggcgctccgct
tccacccactttggtgccagcgagagagcccgcacctacccggccaacagcacctctgcc
tcgacagagcccaggtacagccagtccgcggccgcttcccactcgcctccccccgatccc
ctgccctgcaccgccgtggccgcttcgcccgtcagcgagagtcaccacggggtgaaaaac
tccctgggcaactccagcagcacttcgtccaattccagcagcagcacgcacatcagcagg
gacggggttggcacctcgtccggcaccgaggaagacactccggcgagcagcgagcaggca
agtgccccgagcgaccaaagcacagcacagccttcccagccccagatctacccttggatg
cgaaagctgcacataagtcatgacaacatagggggaccagaagggaaaagggctcggact
gcttacacccggtatcagaccttggagctggaaaaggaatttcacttcaatagatacctg
acccgcagaagaaggattgaaatagcacacgctctttgcctctcagagagacaaataaag
atctggttccaaaacaggagaatgaaatggaaaaaggataataagctgaaaagtatgagc
atggcagctgcagggggggcattccgtccctaa

DBGET integrated database retrieval system