KEGG   Gallus gallus (chicken): 100858727Help
Entry
100858727         CDS       T01006                                 

Gene name
USP19
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 19 isoform X7
  KO
K11847  ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100858727 (USP19)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100858727 (USP19)
Ubiquitin system [BR:gga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100858727 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH USP19_linker UCH_1 CS zf-MYND USP7_C2
Motif
Other DBs
NCBI-GeneID: 100858727
NCBI-ProteinID: XP_003642052
CGNC: 66137
Ensembl: ENSGALG00000006824
Position
12
AA seq 1362 aa AA seqDB search
MSSSTNAPGQRRVSRGLDDATNKKKQKDRANQESKEVSRPELEQAETSQERDLEEELLLD
WKQNADEIIVKLNLGSGSLKVEDVDTFFTDTDCVIKLPDGRQWSCQFYEEIEGSCSKIQC
KKGNFLQLVLQKKIPLHTWSSLLKRKKDGSKELGKGATCWENGKEKASSAELAPEEPRTE
STELPRTRREPSNPKRAQGRSEALGGKSPASPGTQSGPSAKRAVYLKVAPAEEEPNTRVT
GSVEPSKGHGGRSGSRRNGRASQGDVPTALTDLAPPLEKAVIMAKETVPVEMPPLAATTE
VFPHRVATCVEKRVLQPGSPVEASRGRESAPVLGESSKAIPSATRPLGRDGEKRDWSKDD
VALEAAADEPEPFVSLTFVKNDSYEKGNDLVVVHVYVKEIHKETSKVFFREQDFTLVFQT
SDINFLRLHPGCGPHTVFRWQVKLRNLIEPDQCTYNFTASRIDVCLKKRHSQRWGGLEAP
ATRGAVGGAKVAMPTGPTPLDKTPPGSNQHPLSSKEEARTSEKEKPRVEDGSLDGVAART
AQEHVTVKQEPHIPSPKPTCMVPPMTHSPVSAESVEDDEDEDEKKKVCLPGFTGLVNLGN
TCFMNSVIQSLSNTRELRDYFHDRSFESEINYNNPLGTGGRLAIGFAMLLRALWKGTHHA
FQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDE
VVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCSKVSITFDPFLYLPVPLPQKQKVLT
VYYFAKEPHKKPIKFLVSISKENSSAMEVLDSVAHSVHVKPDNLRLAEVIKNRFQRMFLP
SQSLDTVSPTDLLLCFEVLSPELAKERVVELQVQQRPQVPSVPVAKCAACQKKQLSEEEK
LRRCTRCYRVGYCNVTCQKTHWPDHKALCRPENIGFPFLISVPESRLTYARLAQLLEGYA
RYSVSVFQPPFQLGRMSPEQGLQPLLLDKLEPLAKGSCAAATSAPELGDGDRASGLLQEP
PLSPAVPELYPEMSDTGTVRSKVLAARSSLLSLDSGFSEHMDLQGDSCCEKEPSYERALK
PEAAIPGYQHTPDSLSARATQFYINKIDAANKEYKLEDKGDTPLELTDDCSLALVWKNNE
RLKEFVLVESKELECVEDPSSASEAARAGHFTLEQCLNLFTKPEVLAPEEAWYCPKCKQH
REASKQLMLWRLPNVLIIQLKRFSFRSFIWRDKINDMVDFPVRSLDLSKFCIGRKGEQQL
PMYDLYAVINHYGGMIGGHYTAYARLPNDKNSQRSDVGWRLFDDSTVTTVDESQVVTRYA
YVLFYRRRNSPVERPLPGHPPDHRAERTPSAEAAASQHCPTR
NT seq 4089 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcagcaccaatgcccctggccagaggagagtgtctcggggcttggatgatgcc
accaacaagaagaagcagaaggatcgagccaaccaggagagcaaggaagtgtctcgccct
gagctcgagcaggctgagacctcccaggagagggacttggaggaggagttgctgctggac
tggaaacagaatgctgatgagatcattgtcaagctgaacttgggaagtggatctctgaag
gtggaggacgtggatacttttttcaccgatactgactgtgtgatcaaactaccagatggg
cgccagtggagctgtcagttctatgaggagattgagggctcctgcagcaagatacagtgc
aagaagggaaactttctgcagcttgtgcttcagaagaagatccctctccacacctggtct
tcacttctgaagagaaagaaagatggatccaaagagctgggcaagggggccacgtgctgg
gagaacgggaaagagaaggcttcttctgcagaattggcccctgaagagccacggactgaa
agcactgagctgccaagaacccgccgagagccctccaaccccaagcgcgctcagggaaga
agcgaggccctgggagggaaaagcccagccagcccagggacgcagagtggccccagtgcc
aagcgggcagtatacctcaaagtggctccagctgaagaggagccgaataccagagtcacg
gggagcgtggagcccagcaaagggcatggcgggaggtcaggcagccgtcgcaatggcaga
gccagccagggcgatgtgcctacagccctgactgacctcgcaccaccactagagaaggct
gtgattatggccaaggagactgttcctgtggagatgccaccacttgctgctaccacagag
gtgttcccccaccgtgttgccacctgtgtggagaaaagagtcctgcagccaggcagccct
gtcgaagcctcacggggccgggagagtgcacctgtcttgggagagagctctaaggccatc
ccatcagccacgcgtcccctaggtagagatggagagaagagggactggtccaaggatgat
gtggctctggaagcagcagctgatgagccagagccttttgtgagcctgacctttgtcaag
aatgactcatatgagaagggcaatgatctggtggtggtgcacgtgtatgtgaaggagatt
cataaggagacttccaaggttttcttccgggagcaagacttcacactggtgttccagaca
agtgacataaacttccttcgcctccatcctggctgtgggccccacacagtgttccgatgg
caggtgaagctcaggaaccttattgaaccagaccagtgcacgtacaacttcacagcatct
cgcattgatgtctgcttgaagaaacgccatagccaacgctggggggggctggaggctcca
gccacacgaggtgcagtgggtggtgcaaaggttgccatgcctacaggccctacccctctg
gataagacccctccaggcagtaaccagcaccccttgtccagcaaagaggaagcccgaact
agtgagaaagagaagccacgtgtcgaggatgggagtctggatggcgtggcagcccgtaca
gcccaagagcatgtgacagtaaagcaagagccgcacatcccctcgcccaaaccaacctgc
atggtgccaccgatgacgcacagtccagtgagtgctgagagcgtggaagatgatgaggat
gaagatgagaagaagaaggtgtgcctgcctggcttcacagggctggtaaatctgggcaat
acctgcttcatgaacagcgtcatccagtcattgtccaacacccgggagctgcgtgattac
ttccatgatcggtccttcgagtctgaaatcaactacaacaaccctctagggacaggggga
cgcctggctatcggctttgccatgctactacgcgcactgtggaaaggcacacaccatgcc
tttcaaccctctaaattgaaggcaattgtggccagcaaggccagccagttcactggctat
gcccagcatgatgctcaagagtttatggcctttctgcttgatggcctgcatgaggatctc
aaccgcatccagaacaaaccctacacagaaactgttgactcagatgggaggcccgatgag
gtggtagctgaggaggcctggcagagacacaaaatgaggaatgattccttcattgtggac
ctattccagggccagtacaagtcaaagttggtgtgcccagtctgttccaaggtgtccatc
accttcgaccccttcctgtacctcccagtccccctcccacaaaagcagaaggtgctgact
gtctactactttgcaaaggagccgcacaagaaacccatcaagttcctcgtgagtatcagc
aaggagaactccagtgccatggaggtcctcgactcggtggcccacagtgtgcatgtgaaa
ccagacaacctgcgcctagcagaggtaatcaagaaccgcttccaacgcatgttcttgcca
tcccagtctctggacacagtctctcccacagacctgctgctctgcttcgaggtgctgtcc
ccagagctggccaaggagcgggtagtggagctgcaggtccagcagcgcccacaggtaccg
agtgtccctgttgccaagtgtgcagcctgccagaagaagcagctgtcagaagaagagaag
cttaggcgctgcacgaggtgctatcgagtcggttactgcaacgtgacgtgtcagaagaca
cactggccagaccacaaggctttgtgccgccctgagaacatcggtttccccttcctcatc
agtgtgccggaatcccgcctcacttatgcccgcctggcccagctgctggagggctatgca
aggtactccgtcagcgtgttccagcctcctttccagctgggtcggatgtcaccagagcag
ggactgcagcctctgctcctagacaagctggagcccctggccaagggcagctgtgctgct
gccacctctgctcctgagctgggggatggggacagggcttctggcctcctgcaggagcct
cccctctcaccagctgtgcctgagctgtacccagagatgagcgacactggcactgttcgg
agcaaggtcctggctgccaggagttccctgctgagcttggattcgggcttctctgagcac
atggatttgcagggcgacagctgttgcgagaaagagccgtcctatgagagagccctcaaa
ccagaagctgccatccctgggtaccagcacactccagactcgctgagcgcccgtgccacg
cagttctacatcaacaagatcgatgctgccaacaaagagtataagctggaagataaaggt
gacacccccttggagctgacagacgactgttcgcttgccctggtgtggaagaacaatgag
cgcctcaaggaatttgtattggtggagtccaaggagctggagtgtgtggaggatccgagc
tcagccagtgaagcagcccgagctggccacttcaccctggagcagtgcctcaatctcttt
accaagcccgaagtcctggccccagaggaagcgtggtactgccccaagtgcaaacagcac
cgtgaggcctccaagcaattgatgttgtggcgcctgcccaacgtcctcatcatccaactc
aagcgcttctccttccgcagctttatttggagggacaaaatcaacgatatggttgacttc
cctgtccggagcctggacctaagcaaattctgcatcggccggaagggtgagcagcagctg
cccatgtatgacctgtatgctgtaatcaatcactatggaggcatgattggcgggcactac
acggcatacgcccgcctgcccaacgacaagaacagccagcgcagtgacgtgggctggcgg
ctcttcgatgacagcacagtcaccaccgtggacgagagccaggtggtaaccagatacgcc
tatgtcctcttctaccgccggaggaactctcctgtggagagacccctgccagggcacccc
ccagaccaccgagccgagcgcaccccctctgccgaagctgctgccagtcagcactgtccc
acacgctga

DBGET integrated database retrieval system