KEGG   Gallus gallus (chicken): 100858776Help
Entry
100858776         CDS       T01006                                 

Gene name
NEDD8
Definition
(RefSeq) NEDD8 isoform X1
  KO
K12158  ubiquitin-like protein Nedd8
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    100858776 (NEDD8)
Ubiquitin system [BR:gga04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100858776 (NEDD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 100858776
NCBI-ProteinID: XP_015130268
CGNC: 64326
Position
25
AA seq 85 aa AA seqDB search
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
IQGGSVLHLVLALRGGGARRGEGRG
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcaaagtgaagacgctgaccgggaaagagatcgagatcgacatcgaacccacc
gacaaggtggagcgcatcaaggagcgcgtggaggagaaggaggggatccccccccagcag
cagcggctcatctacagcgggaagcagatgaacgacgagaagacggcggccgactacaag
atccagggtggctccgtgctgcacctggtgttagccctccgagggggcggggccaggcgg
ggcgaggggcggggctaa

DBGET integrated database retrieval system