KEGG   Gallus gallus (chicken): 100858894
Entry
100858894         CDS       T01006                                 

Gene name
SMTN
Definition
(RefSeq) smoothelin isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Smoothelin CH CAMSAP_CH
Other DBs
NCBI-GeneID: 100858894
NCBI-ProteinID: XP_015130860
CGNC: 65979
Position
15
AA seq 1038 aa
MAAVGAGGAARGRAGRERDCAGLRGCESGPGPAERCRIGSGREPEPGGGQRAGTMSQESL
QGMDEGALRKLLEATLDLAERRRIRSAIRELQRQELERDEEALASKRFRTERGSHRQDNK
ENWLRSQQLEEEQQKALASLSRELESITDVEELTKLLRAASEYEERKLIRAAIRKLRAEE
IEAATLAGNVQSSRRDGAEPAAVPARAERSRRDDAETAALVGNGESSQRAGSELPAVVSV
ESSVEPVENSRRGDAEQAVLSRTEESSHGGNADRLPAEEPERSVAHEQEEEQEHRQAELQ
DLSNQQLREPQKPPAQASGTLVLLDLHPALEPTAAPQPDERTAEVELRTERASECELQYR
EEGSGSPCSAREPVVEPAEALCSTGQSRQAEQHGPTQPCAGTQSGQFVICVRGQVSGKAV
MPQEKPAAPTQSAARTPSRLNAQRWEQTPSSPCPQGHAEPSPVQRSSSVRERAQRFTPSG
ATPVGTAGRQRAAAGGPEGAGGAAGRAGPGQWQRGPRTAPPGPAQNARGAGGGGAEQRPP
PAGPRPAGTGPTAAHDGMKTYFTIEIKDGRVQPHTQSVTPRIVAAPGSQRAELTLGLRST
PIRITAIPSSTGGICSISTSSNVVKDPCAHFEGTEESGSPVAHPPTFSSTRQLHLSRSNS
FPMEPELVVEQPQAPRLQPELPNGMEKVQVREVEKKSKLNVEELNRIEDEDVLDKMLDQT
TDFEERRLIRNAMRELRQRKRDQREKERDQRLQEMKSQATVSRAGHNTETTTTQSTQSAD
GSARSTVTKTERLIQSNDGSKTSRTTTMESSYVKRSDNGSSSTFVQTKSSYSSSSKKTGS
IFDREDESASRQSSLAALERRQAEKKKELMKAQSLPKTSTSQARKAMIEKLQKEGGSSPN
PAAPRAAVQRSSSCGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVH
NFFPDAFDYSQLTPQNRRHNFEVAFSSAEMLADCVPLVEVEDMMIMGKKPDAKCVFTYVQ
SLYNHLRRHEMRMRQKEC
NT seq 3117 nt   +upstreamnt  +downstreamnt
atggcggcggtgggcgcgggcggggcagcgcggggccgggccgggcgggagcgggactgc
gcggggctgcgcggctgcgagagcgggcccggcccggcggagcggtgccggatcgggagc
ggacgggagccggagcctggcggggggcagcgggcgggcacgatgtctcaggagagcctg
cagggcatggacgagggcgcgctgagaaagctgctggaggcgacgctggacctcgccgag
cggcgccgcatccgctcggccatccgggagctgcagcggcaggagctggagagggacgag
gaggcgctggcctccaaacgcttccgcaccgagcgcggcagccaccggcaggacaacaag
gagaactggctgcggtcccagcagctggaggaggagcagcagaaggccctcgcctcgctg
tcccgggaactcgagtccatcaccgatgtggaggagctgacaaagttgctgcgggcggcc
agcgagtacgaggagcgcaagctgatccgcgccgccatccgcaaactgcgggctgaggag
atcgaagccgcaaccctggctgggaacgtgcagagcagccgcagggatggcgccgagccc
gcagccgtgcccgcacgtgcagaacgcagcaggagggatgatgctgaaacggcagctctg
gttgggaacggggagagctcgcagagggcaggctctgagctgccggccgtggtgagcgtg
gagagcagcgttgagcccgtggagaacagccggaggggcgatgctgaacaggcggtgctg
agcaggacggaggagagcagccatggggggaacgcagacagattgcctgcagaggagcct
gaacgctctgtggcccacgagcaggaagaggagcaggagcacaggcaagctgagctgcag
gacctgagtaaccaacagctgagagaaccccagaaaccccctgcccaggcctcagggacc
ctggtgctcctggacctgcacccagccctggagcccactgcagccccgcagcccgacgag
cgcaccgcagaggtggagctgcgcaccgagcgggcatctgagtgtgagctgcagtaccgg
gaggagggctctggcagcccctgttctgcacgggagcccgtcgtggagccagcagaggcc
ctgtgcagcacagggcagagccgccaggcggagcagcacggcccgacacagccctgtgct
ggcactcagagtggccagtttgtcatctgcgtgcgaggccaggtgtcggggaaggctgtg
atgccgcaggagaagccagcggcgcccacccagagcgcagcgcggaccccatctcgcctc
aacgctcagcgctgggagcaaacaccctcctcgccgtgcccgcagggccatgcagagccg
agccccgtgcagcgctcctcctcggtgcgggaacgcgcgcagcgcttcaccccttcgggc
gcgaccccggtgggcaccgcggggcggcagcgggcggcggcgggcggccccgagggggcg
ggcggcgctgcggggcgggccgggcccggccaatggcagcgggggcctcgcacggccccg
ccgggccccgctcaaaacgcgaggggagccggtggcggaggagcagagcaacgcccgccg
cccgccggcccccgccccgccggtaccggccccaccgccgcccacgacggcatgaagacg
tacttcacgatcgagatcaaggatgggcgcgtgcagccccacacgcagtccgtcacgccc
cgcatcgtggccgcccccggcagccagcgggcagagctcaccctggggctgaggagcact
cccatccgcatcaccgccatccccagcagcaccggcggcatctgcagcatcagcaccagc
agcaatgtcgtcaaagacccttgcgctcattttgagggcaccgaggagtccggcagcccg
gtggcccatccacccactttctccagcacgcgtcagctgcacctctcccggagcaacagc
tttccgatggaaccggagctggtggtggagcagccccaggcaccgaggctgcagccagag
ctgcccaatggcatggagaaggtccaagtgagggaagtggagaagaagagcaagctgaat
gtcgaggagttgaacaggattgaggacgaggatgttctggataagatgctggatcagacc
acagactttgaggagcgacggctgatccgtaatgccatgcgggagctgcgccagcgcaag
cgagaccagcgggagaaggagcgggaccagcggctgcaggagatgaagagccaggctaca
gtgagcagggctggccacaacactgagaccaccaccacgcagagcacccagtcagccgac
ggctcagcccgcagcactgtcaccaaaaccgagcgcctcatccagtctaatgatggcagc
aagacttcccgcacaacaaccatggagtcaagttatgtgaagagatcagacaatggcagc
agcagcacatttgttcaaaccaaatcatcctacagctcatcttccaagaagacaggcagc
atctttgaccgagaggatgagagtgcctcaaggcagagcagcctggctgcgctggaacgg
cgccaggctgagaaaaagaaggagctaatgaaagctcagagcctgcccaagacatcaacc
tcacaggctcgcaaagccatgattgagaagctgcagaaagagggcgggagctctccaaac
cctgcagcaccgcgtgcagctgtgcagcgctcctccagctgtggtgtccccaatgccaac
agcattaagcagatgttgctggactggtgcagggctaagacccggggctacgagcacgtg
gacatccagaacttctcctccagctggagcgatggcatggccttctgtgctttggtccac
aacttctttccagatgcttttgactacagccagctcacaccccagaaccgccgtcacaac
ttcgaggtggcattctcctctgcagagatgctggcggactgcgtgcccctggtggaggtg
gaagacatgatgatcatggggaagaagccagacgccaagtgcgtcttcacctacgtgcag
tccctctacaaccacctgcgtcgccacgagatgcgcatgcggcagaaagagtgctag

DBGET integrated database retrieval system