KEGG   Gallus gallus (chicken): 100858979Help
Entry
100858979         CDS       T01006                                 

Gene name
COL10A1
Definition
(RefSeq) collagen alpha-1(X) chain isoform X2
  KO
K19479  collagen, type X, alpha
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 100858979
NCBI-ProteinID: XP_003641055
CGNC: 64139
Ensembl: ENSGALG00000014965
UniProt: F1NRH2
Position
3
AA seq 674 aa AA seqDB search
MHLQISLLLLFCLNIVHGSDGYFSERYQKQSSIKGPPHFLPFNVKSQGVQMRGEQGPPGP
PGPIGPRGQPGPAGKPGFGSPGPQGPPGPPGPPGFSTVGKPGIPGLPGKPGERGLNGEKG
EAGPVGLPGARGPQGPPGIPGPAGLSVPGKPGPQGPPGAQGPRGLPGEKGEQGVPGINGQ
KGEMGFGVPGRPGNRGLPGPQGPQGLPGPAGIGKPGENGLPGQPGMKGDRGLPGARGEAG
IPGPQGPPGEPGEVGIGKPGPMGPPGPAGIPGAKGLPGPAGLPGSPGLPGFGKPGLPGMK
GHRGPEGPPGFPGPKGDQGPAGVPGEPGPAGPQGNMGPQGLKGLPGENGLPGPKGDMGPV
GPAGFPGAKGERGLPGLDGKPGYPGEQGLPGPKGHPGLPGQKGDTGHAGPPGLPGPVGPQ
GVKGVPGINGEPGPRGPSGIPGIRGPIGPPGMPGAPGAKGEAGAPGLPGPAGIATKGLRG
PMGPPGPPGPKGNSGEPGLPGPPGPPGPPGQSTIPEGYVKGESRELSGMSFMKAGANQAL
TGMPVSAFTVILSKAYPGATVPIKFDKILYNRQQHYDPRTGIFTCRIPGLYYFSYHVHAK
GTNVWVALYKNGSPVMYTYDEYQKGYLDQASGSAVIDLMENDQVWLQLPNSESNGLYSSE
YVHSSFSGFLFAQI
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgcatttacaaatatcgttactgctgctgttttgtctaaacattgtccatggcagtgat
ggatacttttctgagcgataccagaaacagtccagcatcaaggggccaccacactttcta
ccattcaatgtaaagagtcaaggtgtgcagatgaggggtgaacaagggccccctggtccc
ccaggccctattggaccaagaggacaaccaggtcctgcaggaaaacctgggtttggaagc
cctggaccccaaggtccccctggtcccccaggaccacctggattctccactgttggaaaa
ccaggcataccaggtctaccagggaagccaggagaaagaggattaaatggtgagaaagga
gaagccggacccgttgggctcccaggagcaagagggccacaaggaccccctggcattcct
ggccctgcaggactgtctgtccctggaaagccaggaccccaaggccctccaggagctcaa
gggccaagaggcctccctggtgagaaaggagaacaaggtgttcctggtataaatggacaa
aaaggagaaatgggatttggtgttccaggccgcccaggtaacaggggtcttccaggccca
cagggaccccaaggcctccctggtcctgctgggatagggaagcctggagaaaatggcctt
ccaggtcagccaggtatgaaaggtgacagaggtctaccaggagcacgtggagaagctggt
atcccaggcccccagggtccaccaggagaacctggagaagttggcatcggcaagcctggg
ccaatgggaccaccaggaccagcaggcatccccggagccaaaggattgcctggacctgca
ggcctgcctggatccccaggtcttccaggatttggaaagccaggattgccagggatgaag
ggacacagaggacctgaaggacctcctggctttccaggacctaaaggagaccaaggccca
gctggtgtaccaggagaaccaggacctgctgggccacaaggaaatatgggccctcaagga
ctcaaaggcttgcctggtgagaatggcttacccggacccaaaggtgacatgggccctgta
ggccctgcaggattcccaggagccaagggtgaaagaggtctaccaggattagatggtaaa
ccaggatatccaggtgagcagggtcttcctggtcctaagggacatccaggtctccctggt
caaaaaggagacactggccatgctggcccacctggcttgcctggtccagttggaccacaa
ggagttaagggagttccaggtattaatggtgaaccaggcccaagaggaccttcaggaata
cctgggatcagaggccccattggtccccctggcatgccaggagcccctggtgcaaaaggt
gaggcaggagcaccaggactgccaggcccagcaggtattgctacaaaaggtttaagagga
cccatgggaccacctggacctcctggacctaaaggcaacagcggagagcctggcttgcca
ggtccccccggtcctcctggtccccctggccaatccacaatcccagaaggttatgttaaa
ggagagtctagagaactatcaggaatgtctttcatgaaagcaggagcaaatcaagctctc
acaggaatgccagtgtctgccttcactgtcattctctcaaaagcctaccctggggcaaca
gtccccatcaaatttgacaaaatcttgtacaacagacagcaacactatgatcccaggaca
ggaatctttacctgcaggatccctggactatactatttctcctatcatgtacatgcaaaa
ggaacaaatgtttgggttgcactctataaaaatggctccccagtcatgtacacttatgat
gaataccagaaaggataccttgaccaggcctcaggcagtgctgtcattgatctcatggag
aatgatcaagtgtggctccagctgccaaattcagaatccaatggtctctattcctctgaa
tatgttcattcttctttctcaggtttcctatttgctcaaatctaa

DBGET integrated database retrieval system