KEGG   Gallus gallus (chicken): 100859030
Entry
100859030         CDS       T01006                                 

Symbol
FOXB1
Name
(RefSeq) forkhead box protein B1
  KO
K09395  forkhead box protein B
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100859030 (FOXB1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100859030 (FOXB1)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 100859030
NCBI-ProteinID: XP_004943811
CGNC: 64091
Position
10:complement(5697453..5700488)
AA seq 320 aa
MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNS
LRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSEHLAPS
KPADAAQYLQQQAKLRLSALAATGTHLPQMSTYNLGVSQPSSFKHPFAIENIIAREYKMP
GGLAFSTMQPVPAAYPLPNQLTTVGSSIGTGWPHVYGSGVIDTATPISMAGGEYGAYGVP
IKPLCHGGQTLPAIPVPIKPTPAAVPALPALPAPIPTILSNSPPSLSPTSSQTATSQSSP
ATPSETLTSPAPALHSVAVH
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcctcgcccgggcagaaacacttacagcgaccagaagcccccctactcctacatctcc
ctgaccgccatggcgatccagagctctcccgagaagatgctgcccctgagcgagatctac
aagttcatcatggaccgtttcccctactaccgggagaacacgcagcgctggcagaactct
ctgcggcacaacctctccttcaacgactgcttcatcaagatcccgcgccggcccgaccag
ccgggcaagggcagcttctgggcgctgcatcccagctgcggggacatgtttgagaacggc
agcttcctgcggcgccgcaagcgcttcaaggtgctcaagtcggagcacctggcgcccagc
aagccggccgacgcggcgcagtacctgcagcagcaggcgaagctgcgcctcagcgcgctg
gcggccacgggcacgcacctgccccagatgtccacctacaatctcggcgtgtcgcagccg
tccagcttcaagcaccccttcgccatcgagaacataatcgcccgagaatacaagatgccc
ggcgggctcgccttctccaccatgcagcccgtgccggccgcctacccgctccccaaccag
ctcaccacagtgggcagctccatcggcacgggctggccccacgtgtacggctccggcgtg
atcgacacggccacccccatctccatggccggcggcgagtacggcgcctacggcgtgccc
atcaagccgctgtgccacggcgggcaaactttgccggccatccccgtgcccatcaagccg
acccccgccgccgtgccggccctccccgcgctgcccgcgcccatccccaccatcctctcg
aactcgccgccctctctcagccccacgtcctcgcagacggccaccagccagagcagcccg
gccacccccagcgagactctgacgagcccggcgcccgcgctgcactcggtggcggtgcac
tga

DBGET integrated database retrieval system