KEGG   Gallus gallus (chicken): 100859120
Entry
100859120         CDS       T01006                                 

Gene name
AHNAK2
Definition
(RefSeq) protein AHNAK2 isoform X1
  KO
K23934  neuroblast differentiation-associated protein AHNAK
Organism
gga  Gallus gallus (chicken)
Pathway
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100859120 (AHNAK2)
SSDB
Motif
Pfam: PDZ
Other DBs
NCBI-GeneID: 100859120
NCBI-ProteinID: XP_025006644
CGNC: 64005
Position
5
AA seq 4240 aa
MTQSTSFITKGQLLDRGPRQSCPLLPGSGRQLRPAEPPGDADADAEDEDSVNEVAVEDIR
PRPQGSSPVYEYSLEEEYLKLQEENKKHTTDKSKQSHPQETMEVTLKTEVEAGASGFSVA
GGGNEGIFIKKVLKESPASKVFSLREGDQLLSATIFFDNIKYEDALKILQYSEPYRVQFS
LKRKIAGKEELEHFHSTAQYKKERLSQDKELSESIPEETLHVSGKATSEEDRETLIVNQR
VGRSKRPKKDRLSWPKFQSIKNKKILGHRRSHSTSDAYEPAIQDISPTSTDTESQQEIHI
KQKKGSQKKLKFPSIGFRMHRSKTEHQDKQKKEINTTLLYEKQKTDKEDTSLEVPEILTV
EYTASPASEMKTEELNETSTKNLKDGENGIPTYAKKCPEVEISIKKEKEKESTLKYTVTE
VQDVKRKESKPSLEADLKETPMKQTPKTSSRSRKKKQKGTEDKTEGENGIKGDIMDHTAE
VYIEERGLEIGRARAELQSTETQETREKQGEEDKQIPTIQKTKFWMSVSKRKETDTKKIL
TKPEIDVPDSGLETQAEKEIEKRRKMEVEAQTASTETEESRRKITLPTIEMPILPVDDNT
LQDTKVESKYKLKKEQTEERNIQTSDRSSNIEITAKKAEKDVDGKESKQRLPKFKLPTFT
WGSTKDETLKSDILESEIMTARAPKVEMDVSVPKVDASLPEAEVKAGAVDVSILAPDIKP
PSVEGSLDLQAPKVDLKVPSAEGSLDGGELEAAGLKGKFKMPKFDKPKFGVSVPKAEGPE
GEVSLPTAEVELPSGTVTVTGEGPSLDLKADIGGAKTEGAGWKLEKPSLKMPKADIKAPK
VDISLPSVDITLPKAGVDLQAPEAALSLEGEAKAPEKEATKAKDGKFKMPKFGMPSFGWS
SSREAKGTVAADVDVSLKEPQVTAPSGTAKVDVTLPGAEIQAPGVEATIEAAAGADAEKA
RFKMPDVKMPSVKLPKVKAPHVQVSLPKAEISLPKAQGEIPEGELALQGPDAEGSLDVAA
GKAEGGGMKLHMPKVKVPSVAFSKPTVKAPKVEVDVSVPKVDASLPEAEVKAGAVDVSIS
APDIKPPSVEGSLDLQAPKVDLKVPSAEGSLDGGELEAAGLKGKFKMPKFDKPKFGVSVP
KAEGPEGEVSLPTAEVELPSGTVTVTGEGPSLDLKADIGGAKTEGAGWKLEKPSLKMPKA
DIKAPKVDISLPSVDITLPKAGVDLQAPEAALSLEGEAKAPEKEATKAKDGKFKMPKFGM
PSFGWSSSREAKGTVAADVDVSLKEPQVTAPSGTAKVDVTLPGAEIQAPGVEATIEAAAG
ADAEKARFKMPDVKMPSVKLPKVKAPHVQVSLPKAEISLPKAQGEIPEGELALQGPDAEG
SLDVAAGKAEGGGMKLHMPKVKVPSVAFSKPTVKAPKVEVDVSVPKVDASLPEAEVKAGA
VDVSISAPDIKPPSVEGSLDLQAPKVDLKVPSAEGSLDGGELEGAGLKGKFKMPKFDKPK
FGVSVPKAEGPEGEVSLPTAEVELPSGTVTVTGEGPSLDLKADIGGAKTEGAGWKLEKPS
LKMPKADIKAPKVDISLPSVDITLPKAGVDLQAPEAALSLEGEAKAPEKEATKAKDGKFK
MPKFGMPSFGWSSSREAKGTVAADVDVSLKEPQVTAPSGTAEVDVTLPGAEIQAPGIEAT
IEAAAGADAEKARFKMPDVKMPSVKLPKVKAPHVQVSLPKAEISLPKAQGEIPEGELALQ
GPDAEGSLDVAAGKAEGGGMKLHMPKVKVPSVAFSKPTVKAPKVEVDVSVPKVDASLPEA
EVKAGAVDVSISAPDIKPPSVEGSLDLQAPKVDLKVPSAEGSLDGGELEAAGLKGKFKMP
KFDKPKFGVSVPKAEGPEGEVSLPTAEVELPSGTVTVTGEGPSLDLKADIGGAKTEGAGW
KLEKPSLKMPKADIKAPKVDISLPSVDITLPKAGVDLQAPEAALSLEGEAKAPEKEATKA
KDGKFKMPKFGMPSFGWSSSREAKGTVAADVDVSLKEPQVTAPSGTAEVDVTLPGAEIQA
PGVEATIEAAAGADAEKARFKMPDVKMPSVKLPKVKAPHVQVSLPKAEISLPKAQGEIPE
GELALQGPDAEGSLDVAAGKAEGGGMKLHMPKVKVPSVAFSKPTVKAPKVEVDVSVPKVD
ASLPEAEVKAGAVDVSISAPDIKPPSVEGSLDLQAPKVDLKVPSAEGSLDGGELEAAGLK
GKFKMPKFDKPKFGVSVPKAEGPEGEVSLPTAEVELPSGTVTVTGEGPSLDLKADIGGAK
TEGAGWKLEKPSLKMPKADIKAPKVDISLPSVDITLPKAGVDLQAPEAALSLEGEAKAPE
KEATKAKDGKFKMPKFGMPSFGWSSSREAKGTVAADVDVSLKEPQVTAPSGTAEVDVTLP
GAEIQPPDIAFISSSSSVKEESTSKSKVSFFSMPRVLLSRSSKHELQSKSNIECSESESI
CYSVTEESPAVISGSVGSKLVPDVKGDSSSKSTKFRIPSLGFSKVDISSSKFEQDSPLSK
GDVTLTKYQMNAAESESKISSAADVKISFTDLEILNGEGSYEQGIMKPEGVKTPPAELSG
GDTEYTVKIPKFRKPKFGFSWSKGKPSESDIGSKVESEFSTEKMTSEMFDIENPSQIPES
EFGLKMQKTSPEFVTGASKLDVSLPSPEITLPKLEMDIHDPECRKEQELISGKKDTEEKE
SKFKMSKFKLLSFNWSPKKEAIAPSEAEGHLEESTILSGDTESKLAPVIPENQDLHVELD
TATEKHGEMGKTKKSQFIMPKISLTKVMGQKVQGSLPVLETDVCDLKQEKCGDDSVQKSD
KGSSGERAEIGVKMSKVRVSAPEFSKPAVEGPKIEMDISMPAGEVILTSCEQDELTLKSA
ADDIPSSDTKMTIEASLEVKSPETSVERISSEIAMSGVEIKVEGPEGKTKMSKFQMPKFG
MTHSKGKGSEKEVSQTKSEAKVPQIKAMIEIADIAVEAPNLEVECGEGKESSSSKLKITK
DDKKAPEADTHFPTGEISISKTDSDIQDSDMVLKIKEETKHRNEDGEEKEGHFKMPKLKL
PSFSWSPKKEATVKEDSGGNLEDNKVAVMSGRIDTEAEGTVADDQGPRPAFDLEIPAGKD
QQKSPIKKPQFVMPKISLSKIKIPKSQGHSSKVEAGSTVTKTERDGVDSVQIPDIEISHS
TQIEEGAQISIKTAVVKIPTLELSKTEAFQANLGVSSAKIDAALTASEESFQQVVLKSSS
DKDSIQRTGIEFPEGETSVELRSTKIATEGSLVMDGRKMKLEGHDVQIKMPKFQKPKFGI
SLTKGKGPEPEISSPILEAELPQLKMTAEAANIAARAPASEFTSDMSDPGLEVYASKAKT
PQVLTAVIEAPKVDISPQSESKAVIEEDTEGLEEKEIKSEEETKAEEAQTEEHQGWFKMP
KFRIPAFGRTSLKEKKGDADVERSLEKTQAGIPSAKVQTEAEITIGKEEIPKLGDSMEIS
VTSLPKVEGDISLSAERRDSRVNIPKTETYADIVKRGAEGQKMHSSEFTVSSVGLSKREI
SASIIDKDNSSPSKFPMGTLTLQEQKVKSQDIDTPEVESSTEVKTLSAEFKTSSNEITLD
RTQEKIDASLPKGELDLQNQGAVIKTVKIRTSEMKITGKDSELKWSTGEWATAKGSENAV
YVAAKMEDVKVDVPEVKTDVEIERVDPEMKCQVKRVEKDMSANVEAQVEDRAEISKIKTY
KFKIPKFGVLHSEVKGFEDDISLPKSGAVSVTKTEIDRVEMQFQKSEGSIGPTSPTLDHT
ESSARITVETVDKSQDDPEVNIIIPKLKIPRFTFRVLPSEADVSLSKVVTDPKGTSADIE
VVHLQTSSTIPEEIPETLEGDIQKAKSKILTLIEPDIKTAQMTATIDSCLSNAGQDIHWS
YVEGQEVREKVEPEHVSIERCEIYSTQILKESEILSSEVKTATLGFSLLKAKLPESHSNS
EVLVQQSPSMENASVNKSEHSDESFAVTTQRTGTAELKLSDKPPSETEESHRMTGLPTLK
TFAAEVKPFSKPEESHPDKAPEKITAAPPSKDGDITEAQEDEEKYVTNEKEKADSKRSPG
RFKFWLPSIGFSSSGDETSSDSKTEVKKSEETRPEDMKPADTSVSDSSKQGEKTGWFRFP
KLGFTSPSKKAKTVDKEETGHEERRISDEDSPSDKPDVFFDAQESLSPKEIIESEKQEID
GTSSNIPVSQTIVTSSARTELILLEEEKASQPNIPGDTTK
NT seq 12723 nt   +upstreamnt  +downstreamnt
atgacccaaagcacctcattcatcaccaagggacagttgctagaccgaggaccgagacag
agctgcccgctgcttccaggttctggacgacaactgagaccagccgagcctccgggagat
gctgatgctgatgcagaagatgaagattctgttaatgaagtggcagtagaagacatccgt
ccaaggccacagggatcctcaccagtttatgaatattccctagaagaagaatacttaaag
ctgcaagaagaaaacaaaaaacatactactgacaaatcaaaacagagtcatccacaggag
acaatggaagtgaccttgaaaacagaagtggaagctggtgctagtggttttagtgtggct
ggtggtggaaatgaaggaatatttattaaaaaagtacttaaggaatctcctgcttcaaaa
gtgtttagtctgagagaaggtgatcagcttctaagtgctacgatattttttgacaatatc
aaatatgaagatgcactcaagattcttcaatattcagagccatacagagtccaattcagc
ctgaaaagaaaaattgctgggaaagaagagctagaacattttcactctacagctcagtac
aaaaaggaacgattaagtcaggataaagaactcagtgaaagcattcctgaagaaacactg
cacgtttcaggaaaagctacttcagaagaagacagagaaacattaattgtaaaccaaagg
gtaggaagaagcaaaagacctaaaaaagatagattatcatggccaaaattccagtcaatt
aaaaacaaaaagatattgggacacagaagatctcacagtacatcagatgcgtatgagcct
gctatacaggatatttcccctacaagcacagatacagagtctcaacaagaaattcatatc
aaacaaaaaaaaggaagccaaaagaaactgaagttccctagtattggattcagaatgcac
agatccaaaacagaacatcaagacaagcaaaaaaaggaaataaatactacattgttatat
gaaaaacaaaaaacagataaagaagataccagcctggaagttcctgaaatactgactgtt
gaatatactgcttctcctgcttctgaaatgaaaacagaggaattaaatgaaacttcaaca
aaaaatttaaaagatggggaaaatggtattcctacttatgcaaaaaagtgccctgaagtt
gaaataagcattaaaaaggaaaaggaaaaggaatcaacactgaagtatactgtaactgaa
gtacaagatgtaaaaagaaaggaatcaaagcccagtttagaagcagatctgaaagaaacc
ccaatgaaacaaacaccaaaaacctcatcaagatcccgaaaaaagaagcaaaaaggaaca
gaagataaaacagaaggagaaaatggaattaaaggagacataatggatcacacagcagaa
gtatacatagaagaaagaggtttagaaataggtagagctagagctgaattacagtcaact
gagacacaggaaacaagagaaaaacaaggagaagaggacaaacagataccaacaattcag
aaaacaaaattttggatgtcagtgtcaaaaagaaaagaaacagacactaaaaagatatta
accaaaccagaaatagatgttccagattcaggactggaaacacaagctgaaaaagaaatt
gagaaacgcaggaaaatggaagtggaagctcagacagcaagtacagaaacagaagaatct
agaaggaaaattacattaccaacaattgaaatgcccatattaccagtagatgacaataca
ctacaagacaccaaagtagaatccaaatataaactcaaaaaggaacagacagaagaaaga
aacatacagacaagtgacagaagttcaaacatagaaattactgcaaagaaagcagaaaaa
gatgttgatggaaaagaaagcaaacagagattaccaaaatttaaattacctacatttaca
tggggaagtacaaaggatgaaacgctgaaatctgacattctagaaagtgagataatgact
gccagggctcccaaagtcgagatggacgtcagtgtgcccaaagtggacgccagcctccct
gaggcagaggtcaaggccggcgccgtcgacgtcagcatcttggcccccgacatcaagccg
ccctccgtggagggctccctcgacctccaggcgcccaaggtagacctgaaagtgccctct
gccgaaggctcgctcgacggaggcgagctggaagccgcaggcctcaaaggcaagtttaag
atgcccaagttcgacaagcccaaattcggagtgtcggtgcccaaggcggaagggcccgaa
ggcgaggtcagcctgcccaccgcagaggtcgagctgccctccggcaccgtgacggtcaca
ggggaaggcccctcactggacctcaaagctgacattggcggtgccaaaaccgaaggcgct
ggctggaaactggaaaagccctccctcaaaatgcccaaagctgacatcaaagctcccaag
gtagacatcagcctgccctccgtcgacatcacccttccaaaggccggtgtcgacctgcag
gcgcccgaggccgcgctcagcctcgaaggggaggcaaaagccccagagaaggaggccacg
aaggcaaaagacggcaagttcaaaatgcccaagttcggcatgccttcctttggctggtcc
agcagcagagaggccaagggcaccgtagctgccgatgtggacgtgagcctcaaggagccc
caggtgaccgcaccctcgggaaccgccaaagtcgacgtgaccctgcccggggccgagatc
caagcgcccggcgtcgaggcgaccatcgaggcggccgccggcgcagacgcggagaaagcc
cgcttcaaaatgcccgacgtcaagatgcccagcgtcaagctgcccaaagtcaaagctccc
cacgtgcaggtcagcctgccaaaggccgagatctcgctgcccaaagcccagggcgaaatc
ccggagggcgagctcgccctgcagggccccgatgccgaaggcagcctggacgtggccgcc
ggcaaagcggagggcggcggcatgaaactccacatgccaaaagtcaaggtgcccagcgtg
gccttctccaagccgaccgtcaaggctcccaaagtcgaggtggacgtcagcgtgcccaaa
gtggacgccagcctccctgaggcagaggtcaaggccggcgccgtcgacgtcagcatctcg
gcccccgacatcaagccgccctccgtggagggctccctcgacctccaggcgcccaaggta
gacctgaaagtgccctctgccgaaggctcgctcgacggaggcgagctggaagccgcgggc
ctcaaaggcaagtttaagatgcccaagttcgacaagcccaaattcggagtgtcggtgccc
aaggcggaagggcccgaaggcgaggtcagcctgcccaccgcagaggtcgagctgccctcc
ggcaccgtgacggtcacaggggaaggcccctcactggacctcaaagctgacattggcggt
gccaaaaccgaaggcgctggctggaaactggaaaagccctccctcaaaatgcccaaagct
gacatcaaagctcccaaggtagacatcagcctgccctccgtcgacatcacccttccaaag
gccggtgtcgacctgcaggcgcccgaggccgcgctcagcctcgaaggggaggcaaaagcc
ccagagaaggaggccacgaaggcaaaagacggcaagttcaaaatgcccaagttcggcatg
ccttcctttggctggtccagcagcagagaggccaagggcaccgtagctgccgatgtggac
gtgagcctcaaggagccccaggtgaccgcaccctcgggaaccgccaaagtcgacgtgacc
ctgcccggggccgagatccaagcgcccggcgtcgaggcgaccatcgaggcggccgccggc
gcagacgcggagaaagcccgcttcaaaatgcccgacgtcaagatgcccagcgtcaagctg
cccaaagtcaaagctccccacgtgcaggtcagcctgccaaaggccgagatctcactgccc
aaagcccagggcgaaatcccggagggcgagctcgccctgcagggccccgatgccgaaggc
agcctggacgtggccgccggcaaagcggagggcggcggcatgaaactccacatgccaaaa
gtcaaggtgcccagcgtggccttctccaagccgaccgtcaaggctcccaaagtcgaggtg
gacgtcagcgtgcccaaagtggacgccagcctccctgaggcagaggtcaaggccggcgcc
gtcgacgtcagcatctcggcccccgacatcaagccgccctccgtggagggctccctcgac
ctccaggcgcccaaggtagacctgaaagtgccctctgccgaaggctcgctcgatggaggc
gagctggaaggcgcgggcctcaaaggcaagtttaagatgcccaagttcgacaagcccaaa
ttcggagtgtcggtgcccaaggcggaagggcccgaaggcgaggtcagcctgcccaccgca
gaggtcgagctgccctccggcaccgtgacggtcacaggggaaggcccctcactggacctc
aaagctgacattggcggtgccaaaaccgaaggcgctggctggaaactggaaaagccctcc
ctcaaaatgcccaaagctgatatcaaagctcccaaggtagacatcagcctgccctccgtc
gacatcacccttccaaaggccggtgtcgacctgcaggcgcccgaggccgcgctcagcctc
gaaggggaggcaaaagccccagagaaggaggccacgaaggcaaaagacggcaagttcaaa
atgcccaagttcggcatgccttcctttggctggtccagcagcagagaggccaagggcacc
gtagctgccgatgtggacgtgagcctcaaggagccccaggtgaccgcaccctcgggaacc
gccgaagtcgacgtgaccctgcccggggccgagatccaagcacccggcatcgaggcgacc
atcgaggcggccgccggcgcagacgcggagaaagcccgcttcaaaatgcccgacgtcaag
atgcccagcgtcaagctgcccaaagtcaaagctccccacgtgcaggtcagcctgccaaag
gccgagatctcgctgcccaaagcccagggcgaaatcccggagggcgagctcgccctgcag
ggccccgatgccgaaggcagcctggacgtggccgctggcaaagcggagggcggcggcatg
aaactccacatgccaaaagtcaaggtgcccagcgtggccttctccaagccgaccgtcaag
gctcccaaagtcgaggtggacgtcagcgtgcccaaagtggacgccagcctccctgaggca
gaggtcaaggccggcgccgtcgacgtcagcatctcggcccccgacatcaagccgccctcc
gtggagggctccctcgacctccaggcgcccaaggtagacctgaaagtgccctctgccgaa
ggctcgctcgacggaggcgagctggaagccgcgggcctcaaaggcaagtttaagatgccc
aagttcgacaagcccaaattcggagtgtcggtgcccaaggcggaagggcccgaaggcgag
gtcagcctgcccaccgcagaggtcgagctgccctccggcaccgtgacggtcacaggggaa
ggcccctcactggacctcaaagctgacattggcggtgccaaaaccgaaggcgctggctgg
aaactggaaaagccctccctcaaaatgcccaaagctgacatcaaagctcccaaggtagac
atcagcctgccctccgtcgacatcacccttccaaaggccggtgtcgacctgcaggcgccc
gaggccgcgctcagcctcgaaggggaggcaaaagccccagagaaggaggccacgaaggca
aaagacggcaagttcaaaatgcccaagttcggcatgccttcctttggctggtccagcagc
agagaggccaagggcaccgtagctgccgatgtggacgtgagcctcaaggagccccaggtg
accgcaccctcgggaaccgccgaagtcgacgtgaccctgcccggggccgagatccaagcg
cccggcgtcgaggcgaccatcgaggcggccgccggcgcagacgcggagaaagcccgcttc
aaaatgcccgacgtcaagatgcccagcgtcaagctgcccaaagtcaaagctccccacgtg
caggtcagcctgccaaaggccgagatctcgctgcccaaagcccagggcgaaatcccggag
ggcgagctcgccctgcagggccccgatgccgaaggcagcctggacgtggccgccggcaaa
gcggagggcggcggcatgaaactccacatgccaaaagtcaaggtgcccagcgtggccttc
tccaagccgaccgtcaaggctcccaaagtcgaggtggacgtcagcgtgcccaaagtggac
gccagcctccctgaggcagaggtcaaggccggcgccgtcgacgtcagcatctcggccccc
gacatcaagccgccctccgtggagggctccctcgacctccaggcgcccaaggtagacctg
aaagtgccctctgccgaaggctcgctcgacggaggcgagctggaagccgcgggcctcaaa
ggcaagtttaagatgcccaagttcgacaagcccaaattcggagtgtcggtgcccaaggcg
gaagggcccgaaggcgaggtcagcctgcccaccgcagaggtcgagctgccctccggcacc
gtgacggtcacaggggaaggcccctcactggacctcaaagctgacattggcggtgccaaa
accgaaggcgctggctggaaactggaaaagccctccctcaaaatgcccaaagctgacatc
aaagctcccaaggtagacatcagcctgccctccgtcgacatcacccttccaaaggccggt
gtcgacctgcaggcgcccgaggccgcgctcagcctcgaaggggaggcaaaagccccagag
aaggaggccacgaaggcaaaagacggcaagttcaaaatgcccaagttcggcatgccttcc
tttggctggtccagcagcagagaggccaagggcaccgtagctgccgatgtggacgtgagc
ctcaaggagccccaggtgaccgcaccctcgggaaccgccgaagtcgacgtgaccctgccc
ggggctgagatccaaccacctgacattgcttttatctctagttcatcctctgttaaagag
gagtctactagcaaatctaaagtttccttttttagtatgcctagagttttactttctaga
agttcaaagcatgagcttcaaagtaagtctaatattgaatgttctgagtcagaatctatt
tgttattctgtaacagaggagtctcctgctgtgatatctggcagtgttggaagtaaactc
gttcctgatgttaagggggacagctcttctaaaagcactaaatttagaattcctagttta
ggtttctccaaagttgatattagttcttctaaatttgaacaagattctccattatctaaa
ggagatgtgactcttaccaaatatcaaatgaatgcagctgaatctgaatcaaaaatatca
tcagctgctgatgtgaaaatttcatttacagatcttgagattttgaatggagagggttct
tatgaacaaggaattatgaaaccagaaggagtaaaaacgccacctgctgagctgtctggt
ggtgacacagaatatactgttaaaatacctaagttccgaaaaccaaagtttggattttct
tggtcaaagggaaaaccatcagaaagtgacattggttccaaagtggaatctgaattttcc
acagaaaagatgacatctgagatgtttgatattgaaaatccatctcagattcctgaatct
gagtttggcctaaaaatgcaaaagacctcacctgaatttgttacgggtgcatcaaagttg
gatgttagtctgccatcaccagagattaccttgccaaaattagaaatggatatccatgac
ccagagtgcaggaaagagcaggaattaatttctggtaagaaggacactgaggagaaagaa
agcaaatttaaaatgtcaaaattcaaactactgtcatttaattggtcaccaaagaaagaa
gctattgctccttctgaagctgaaggacatctggaagaatccactattttatctggagac
acagaatctaaactagcaccagttatccctgagaatcaagaccttcatgtggaattagat
accgcaacagaaaaacatggtgaaatgggcaaaaccaagaagtctcagtttatcatgcca
aagatctcacttactaaagttatgggtcaaaaagtccagggctctctgcccgtactagaa
actgatgtttgtgatctcaaacaagaaaaatgtggagatgattcagtacagaaatctgac
aaagggagtagtggagaaagggcagaaataggtgtaaagatgtcaaaagttagagtttca
gctccagaattttccaaacctgcagttgaaggacccaaaatagaaatggatattagcatg
cctgcaggtgaggtcatacttacttcttgtgaacaggatgagctgacactgaaatcagct
gctgatgatattccttcctcagatactaagatgacaattgaagcgtcacttgaggtgaag
agtcctgagacaagtgttgaaagaatatcaagcgaaattgccatgagtggtgtagaaata
aaagttgaaggtcctgaagggaaaacaaaaatgtcaaaattccaaatgccaaagtttgga
atgacgcattctaaagggaaaggatcagaaaaggaggtcagccaaaccaaatcagaagcc
aaggttccccaaataaaagcaatgatagaaatagctgacattgccgtggaagcaccaaat
ttggaggtggaatgtggtgaaggaaaagaatcttccagctctaagttgaaaataactaaa
gatgacaagaaggcaccagaagctgatactcacttcccaacgggtgagatttctatctca
aaaacagacagtgatattcaagattcagatatggtcctaaaaattaaagaggaaacaaag
cacaggaatgaagacggagaagagaaagaaggacatttcaaaatgccaaaactcaaactt
ccatccttcagttggtcaccaaagaaggaagcaactgttaaggaagattctggaggaaat
ttagaagataataaggttgctgtaatgtcaggcagaatagacacagaagcggaaggaact
gtagctgatgatcaaggacctaggcctgcctttgatctggaaatacctgctggaaaagat
caacaaaaaagtccaattaaaaagcctcagtttgtcatgcctaaaatttcactttccaag
atcaagattcccaaatctcagggacattcatcaaaagttgaagctgggagtactgtaact
aaaacagaaagagatggagttgattcagtacagatacctgatatagaaataagtcattcc
acacagatagaagaaggggcgcaaataagcataaaaacagctgtagttaagatccccact
ttggagctttccaaaacagaagccttccaagctaatttgggagtcagctcagccaagatt
gatgctgctctgactgcctccgaggagagttttcaacaggttgtcctaaaatcaagttct
gataaagattcaattcaaagaacaggcattgagttccctgaaggagaaacttcagttgaa
ctgagaagcaccaaaatagcaactgaaggatcattagttatggatggaagaaagatgaaa
ttggaaggtcacgatgtacagattaaaatgcccaaattccagaagccaaagtttggaatc
tccctgacaaaagggaaaggcccagagccagaaatcagctctccaatattagaagctgag
ctacctcagctaaaaatgacagcagaagctgctaacattgctgcgagagcgccagcatca
gaatttacatctgatatgtcagatcctgggctagaggtttatgcttcaaaggcaaaaaca
cctcaagttctgacggctgtcattgaagctccaaaggtagacataagcccccagtcagag
tctaaagcagtgatagaggaagacactgagggccttgaggagaaagaaatcaaatcagaa
gaagaaacgaaagctgaagaagctcagactgaagaacatcagggatggtttaaaatgcca
aaattcagaatacctgcatttggccgcacatccttaaaggaaaagaaaggtgatgctgat
gttgaaagaagcctggaaaaaactcaggcaggcattccttctgccaaagtacaaactgaa
gctgaaattactattggaaaagaagaaattccaaaattaggagattctatggagatttct
gttactagcttgccaaaggtagaaggagatatttcattgtctgcggaaagaagagatagt
agagtaaatattccaaaaactgaaacttatgcagacatagttaagcgtggtgctgaagga
caaaaaatgcacagttcagaattcacagtatcttcagtgggattatctaaaagagaaata
agtgcttcaataattgacaaagataacagttcaccaagtaagttccctatgggtactctg
actcttcaagagcaaaaagtcaaatcacaggatatagatactccagaggtagaaagttcc
actgaagtaaagactttaagtgcagaatttaaaacatcatcaaatgaaattactctggac
agaacacaggaaaaaatagatgcaagtcttccaaagggagaattagaccttcaaaatcaa
ggggcagtgattaaaacagtaaagataaggacaagtgagatgaaaattacaggaaaagac
agtgagttaaaatggtctacaggtgagtgggctactgcaaagggatcagaaaatgccgtt
tatgttgcagctaagatggaagatgtaaaggtagatgttccagaagtgaaaacggatgtt
gaaattgagagggtagatcctgaaatgaaatgtcaagtgaaacgtgttgaaaaggacatg
tctgcaaatgtggaagcgcaagtagaagatagagcagaaataagtaaaattaaaacatac
aagtttaagattccaaagtttggagtactacattcagaagtgaagggttttgaagatgat
atcagtttgccaaagtcaggagctgtttcagtgactaaaactgaaatagacagagtggaa
atgcagtttcaaaaatcagaaggatccattggcccaacaagtccaactctagatcacacg
gaatcatctgctagaataacagtggaaacagtggacaaatcacaagatgatccagaagta
aatataataattcccaaactaaaaataccaagattcactttcagagttctcccaagtgaa
gctgatgtttcattgtcaaaagtggtaacagatccaaaaggaactagtgctgacattgaa
gtggtgcacttgcaaacaagctctactatccctgaggaaataccagagactctggaaggt
gatattcaaaaagcaaaaagcaaaattctaacactgattgaacctgacattaaaacagca
cagatgactgctaccatagattcctgcctttcaaacgcagggcaagacattcattggtca
tacgtagaaggccaagaagtgagagagaaagtagaacctgaacatgtttctattgaaagg
tgtgagatttactctacccagatactgaaggaatcagagattctctcatcagaagttaaa
actgctactttgggattttcattgctcaaggctaagttgcctgaatcacacagcaactca
gaagtgctagtccagcagagcccttcaatggaaaatgcatcagtgaacaaatctgaacat
tctgatgaaagttttgcagtaactacacagaggactggcactgctgagcttaaactatcc
gacaaaccacccagtgagactgaagaatctcacagaatgacaggtttaccaacgttaaaa
acatttgctgctgaagtaaagcctttcagtaaacctgaagagagtcatcctgataaggca
ccagagaaaataactgcagctcctccctctaaagatggggatataaccgaagcacaagaa
gatgaagaaaagtatgtaactaatgaaaaagaaaaggctgacagcaaaaggtctcctgga
agattcaaattttggcttccaagtattggcttttcatcttctggtgatgaaacaagctca
gattcaaaaacagaagtaaaaaaatcagaagaaacaaggccagaagatatgaaacctgct
gacacatcagttagtgattcttctaagcaaggtgaaaaaactggatggtttagatttccc
aaactaggtttcacatctccttccaaaaaagctaagactgttgacaaagaggagacaggt
catgaagagagaagaatatcagatgaagacagcccttcagataaacctgatgtatttttt
gatgcacaagaaagcttatcacctaaagaaataatagagagtgaaaaacaagaaattgat
gggacctcatctaacattccagtttcccaaactatcgtgacatcttcagcaaggactgaa
ctaatcttgttggaggaagaaaaagctagtcaacctaatatccctggagatacaaccaaa
tga

DBGET integrated database retrieval system