KEGG   Gallus gallus (chicken): 100859181
Entry
100859181         CDS       T01006                                 

Gene name
PRKACA
Definition
(RefSeq) cGMP-dependent protein kinase 1-like isoform X2
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04540  Gap junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100859181 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    100859181 (PRKACA)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100859181 (PRKACA)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  PKG family
   100859181 (PRKACA)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Cupin_2 Pkinase_fungal Kinase-like APH Seadorna_VP7
Other DBs
NCBI-GeneID: 100859181
NCBI-ProteinID: XP_015140503
CGNC: 63947
Ensembl: ENSGALG00000042543
Position
3
AA seq 663 aa
MERWLRDLRLEEERAFLQRAARGPDDGGDLPDAEPPPSSPHRRAPAIVPEPLPGDAAAPP
PPPGTNSQRDLALIAEAVQRSDFLRRLGEGCPEALARSFVTVRHEAGDTVVAEGDEGNAM
YIVAEGRLSVTQRGRQLRTLGPGDVFGELAILYHCRRTATVRALGPVRLWAIDRQRFRAI
TTGNARQRRADVLRVLRTVHWLEELSDSHLSKLLDAMEECSFAPGHVIIREGDEGQSFYI
ILKGEVRVSRREDGQEKLLRVLGTGEHFGELSLLQNIRRTASCQAQGHVTCITVAKEDFL
EIIPFCPRHDSDVNASAPEVPTPKEPRRSWGSSHLPQPCPAVQLEELAAVYYEEGQKQGQ
RVVLGTGGFGRVELVRCREQLFALKRIRKDWVVRTRQQEHMCTERRVLARSHCPFIVGFF
GSFRDAQHIYLLLEFCQGGELWTKLREVRCFEEPLAVFCSACVVEGLEYLHGHGIVYRDL
KPENLMLDQLGYVKLVDFGFAKELERGEKTFSFCGTPEYLAPEMLRHEGHDFAVDFWMLG
ILVFEMLVGRPPFHSADPQKIYSRILDGIFSFPAFLSEAACSLIAKLCRRRPGQRLGNTA
SGIRGIKKHRWFGAIRWKRLALRQMEAPTVQLLKEGPPYANFKRFSVDSTPVEDELSGWD
EEF
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggagcggtggctgcgtgacctgaggctggaggaggagcgcgccttcctgcaacgcgcg
gcgcggggaccggacgacggcggggacctcccggacgccgagccgcccccctcctccccg
caccgccgcgcccccgccatcgtgcccgagcccctcccgggcgacgccgccgcgcccccg
ccgccccccggaaccaactcgcagagggacctggccctgatagcggaggccgtgcagcgc
agcgacttcctgcggcgtttgggagagggctgccccgaggctctggcgaggagcttcgtg
accgtgcgacacgaggccggcgacacggtggtggccgagggcgacgaggggaacgccatg
tacatcgtggcagagggacgtctgagcgtgacccagcggggccggcagctccgcactttg
gggcccggggacgttttcggcgagttggccatcctgtatcactgccggcgcaccgccacc
gtgcgagcgctcggccccgtgcgcctctgggccattgaccggcagcggttccgtgccatc
acaaccggcaacgcccggcagaggagagccgatgtgctgcgggtcctgagaacggtgcac
tggctggaggagctgtcggacagccacctgtccaagctgcttgacgccatggaggagtgc
tccttcgcacccggccacgtcatcatccgcgagggtgacgaggggcagagcttctacatc
attctgaagggcgaggttcgggtcagccggcgtgaggatgggcaggagaagctgctgcgg
gtgctgggcacgggcgagcactttggggagctctcactgctgcagaacatccgccgcaca
gcgtcatgccaagcacagggacatgtcacctgcatcaccgtggccaaggaggacttcctg
gagatcatccccttctgcccccgtcacgattcagatgtaaatgcgtctgcaccagaggtg
cccaccccgaaggaacccaggcggagctgggggtcctcccacttgccgcagccctgccca
gcagtgcagctggaggagctggcggctgtgtactatgaggagggacagaagcaggggcag
cgcgtcgtgctgggcaccggcggcttcggcagggtggagctggtgcggtgccgtgagcag
ctctttgcgctgaaacggatccgcaaggactgggtggtgcggacacggcagcaggagcac
atgtgtacggagaggagggtgctggcccgcagccactgccccttcattgtggggttcttt
ggctccttccgtgacgcgcagcacatctacctgctgctggagttctgccagggcggagag
ctgtggaccaagctgcgtgaggtgcgctgctttgaggaaccgctggccgtgttctgctct
gcatgtgtggtggagggactggagtacctgcacggccacggcatcgtctaccgggacctg
aagcccgagaacctgatgctggaccagctgggttacgtcaagctggtggactttggcttc
gccaaggagttggagcgcggggagaagacgttctccttctgcgggacgcccgagtacctg
gcgcccgagatgctgcgccacgaaggccacgacttcgcagtcgacttctggatgctgggc
atcctcgtgttcgagatgctggtgggcaggccccctttccacagtgctgacccccagaag
atctacagccgcatcctggatggcatcttctccttccccgccttcctcagtgaggctgcc
tgctctctcattgccaagctctgcaggaggcgcccagggcagcgcctggggaacacagcc
agtggcatccgtggcattaagaagcacaggtggttcggagccatccgatggaagcgactc
gcgctgcggcagatggaggcacccactgtgcagctactgaaggagggccccccctacgcc
aacttcaagcggttctcggtcgattcgacgccggtggaggatgagctttcgggatgggat
gaggagttctga

DBGET integrated database retrieval system