KEGG   Gallus gallus (chicken): 100859200
Entry
100859200         CDS       T01006                                 

Gene name
MLH3
Definition
(RefSeq) DNA mismatch repair protein Mlh3 isoform X1
  KO
K08739  DNA mismatch repair protein MLH3
Organism
gga  Gallus gallus (chicken)
Pathway
gga03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100859200 (MLH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gga03400]
    100859200 (MLH3)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100859200 (MLH3)
SSDB
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100859200
NCBI-ProteinID: XP_004941860
CGNC: 66149
Ensembl: ENSGALG00000010304
Position
5
AA seq 1440 aa
MIKHLAEDVQARLRSGVTVTSLGQCVEELVLNSIDAKATCVAVRVDLEAFKIQVVDNGSG
MGKEDLSKMGKRYFTSKCSSVADLEKLTFYGFRGEALASIANMASVVEVSSKSSKTAKTF
VKLFHNGHALEVCEAELSRPSGGTTVTVCNLFYQLPVRRRCMDPVLEFERVRQKVEAISL
MHPSVSLSLRNDISCSMVLQLPKTRDVYSRFCQIYGLGRSQKLREIKHKSGGFEISGYIS
SEGHYNKNMQFLYVNRRLVLKTRLHKLIDFLLRKESVICKAKSVPASKQGSSSPGRLRCG
PELYGIFVLNVTCAYSDYDVSLEPTKTLIEFQNWDVLLACVEEGVKMFLKREHLFVEPCC
EDIKEFNEDNNFCLYNAPVMKSTLPDDKSIQENFKKACDEIIDSYEVCKLQSKDVKRKSV
VGKKSSNLTESNKNTQETVCEISSNQKIAELAGQCRNKKAEIPLPKKDDTTSNFITSDMS
EQEPKDTNSSQKGCDTHLKSSENLHSSFTEGARSEIIKTDSCADLRRCAENCAKDVGNQQ
DKDVQKSNTVCISNNGFTQWPSEREDPTETAGESETVYGSSLIRLHNVREGDRETAEAID
NAGRGAVSSVPEKVHSYLGLQTPVMQNEPPHKRKQTETNLALNMHCRAGPVSAKHTSGHK
VSLPIQSLNAKYISNNMNKEYIPLCSREVGTTDGSEQSENKSLPSQARDGRDMSTATSKR
HYETSNVSDLPLATSSGIPHSKAVKSPRRQIPEPRSQPCKKLSLSTQLGSLEKFRRYYGR
VKCTLSTPLPEQSEFRLPVLNAQANCDVSRSQNNSHGRSSICETPTLDSNNNSHVLRSLD
EVLLCSEETSPDKRALCHSPLTLSDYSEVSKKTTSSQRSPGSLSSKLCQMKSDHRAVKQL
GEQLQTDASRKDNHSYGLESSNNDFLYNPCQRYKSSVEEMRDGCSVSKGDACPQSVDLRA
ESMKCTVSLSPLSSTEGEYAVSASSVLPFPAKKDGMDTICEDESMLDESSKQNEKEPEVD
CMTFPSNLAFSADNASTGDPRDDLHSSDWLQDFDALLGKTVYINKATGLSTYNTPPEEFP
AACIKDLTTMAVNVVSENGFQCRCHPFRSETVLPFLPRPRKEKTLASQDQRGGEGESLQS
MLSEWDNPVFVRCPEIAVDVTSGQAENLAVKIHNVLYPYRFTKDMIHSMQVLQQVDNKFI
ACVINTRNEMDKKEGGNLLVLVDQHAAHERIRLEQLIADSYDKEATACGKKKLLSSSVSP
PLEIEVTEEQRRILWCCYKNLKDLGLELSFPETNSSMILVKKVPLCFIEREANELRRKRQ
PVTKSIVEELIQEQVELVQTMRGAQGTLPLTFLKVLASQACHGAIKFNDSLTSEESCRLM
EALSSCQLPFQCAHGRPSMMPLADIDHLQEEMQPKPNLARLRKMVRAWQLFGNKDPNQKR
NT seq 4323 nt   +upstreamnt  +downstreamnt
atgatcaagcacttggcagaggacgtgcaagccaggctgcgctctggagtgacggtcacc
tcgctgggacagtgtgttgaggagcttgtcctcaacagcatcgatgccaaagcaacgtgt
gtagctgttagggtggatttggaagcttttaagatccaggtggtggataatggctctggc
atggggaaagaggacttaagtaaaatgggaaagcggtacttcactagtaagtgcagctca
gtggcagacttagagaagctgacgttctacggctttagaggggaggctctggcaagcata
gcaaacatggccagtgttgtggaagtttcatctaagagcagcaagacggcaaaaactttt
gtgaaactgtttcacaatgggcatgcactggaagtctgcgaagctgagttgagcagacca
agtggcggaacgacagtgaccgtgtgtaatttgttctatcagttaccagtgaggaggagg
tgtatggatcctgtgctggaatttgagagggtgaggcagaaagtagaggctatctcgttg
atgcatccctctgtttcactttctttaaggaatgatatttcttgttctatggtgcttcag
cttcccaagacaagagatgtctactctcgtttttgtcaaatatatggactgggcagatct
cagaagttgagagaaataaagcataagtctgggggatttgagataagtggttacatcagt
tctgagggacattacaataagaatatgcaattcttgtacgtgaatagaaggcttgtttta
aagacaagattacataaactgattgactttctgttaagaaaagaaagtgtcatttgtaag
gcaaaaagtgtccctgcgagcaaacagggttcctcaagtcctggtcgccttcgttgtggc
ccagagttgtatgggatctttgttctcaatgtgacctgtgcgtacagtgactatgatgtg
tctctggaacctacaaaaactctgattgagttccagaactgggatgttcttctagcttgt
gtagaggaaggagtgaaaatgtttctgaaacgagaacatttattcgttgaaccttgttgt
gaggacatcaaagagtttaatgaggataataatttttgtttgtataatgctccagttatg
aaatccacactccctgatgataagagcatccaggaaaactttaagaaagcatgtgatgaa
attatagattcctatgaagtgtgtaaattgcaatcaaaagatgtcaaaagaaaatccgtg
gtgggaaaaaaatcttcaaatcttacagagtcaaataaaaacacacaggaaactgtgtgt
gaaatttcctcaaatcagaagattgctgaactcgctggtcaatgtagaaacaaaaaagca
gagattccactgcccaagaaagatgacaccacttctaatttcattacatctgatatgtca
gagcaggagccaaaagacacaaacagttcccaaaaagggtgtgatactcatctcaaatct
tcagaaaatctccattcctctttcaccgaaggggccagatcagaaataataaaaacagac
agttgtgctgacttgcggcgttgtgctgagaattgtgcaaaagatgtgggaaaccagcaa
gacaaagatgtgcagaaaagcaatacggtttgtatttcaaataatggttttactcagtgg
ccatctgagagagaagaccctactgaaaccgcgggggaatctgaaactgtctatggaagt
tcattgataagactacataatgtaagagaaggcgacagggaaacagctgaagcaatagac
aatgctggaagaggggctgttagttcagtaccagaaaaagtgcattcttacttaggcctc
caaacacctgtcatgcaaaatgagccaccccacaaacgtaaacaaacagaaacaaatctt
gcattaaacatgcactgcagagctggccctgtcagtgccaagcatacttctgggcacaaa
gtgagcttgccgattcagtctttaaatgctaagtatatctccaataatatgaataaagaa
tatatacctctctgcagcagagaagtaggcacgactgatggaagtgagcagtcagagaat
aaaagtttgccaagtcaagcgcgtgatgggagagacatgtccactgccaccagtaaaaga
cattatgaaacatcaaatgtatcagacttgccgctggcaacatcttcaggtattcctcac
agtaaagctgtaaaaagccctagaagacaaatacctgagccaagatcacagccttgcaag
aagctgagcctatctactcaactgggttcattagaaaagttcaggaggtattatggacgt
gtcaagtgtacgctatcgacaccattaccagagcagagtgaatttcgtctcccagttctt
aatgcacaagctaattgtgacgtttcaaggagtcagaataacagtcatggtcgctcgagc
atttgtgagactccaactttggattctaataataatagccatgttttgagatctttggat
gaagttttactctgcagtgaagaaacttcaccggacaagcgagccctttgtcacagtcct
ttgacgttgtctgattactcagaggttagtaaaaaaaccacaagtagccaaagatctcca
ggatctctgtcatccaaactgtgccaaatgaaaagtgatcaccgagcagtaaaacagctg
ggagaacaactccaaacagatgcaagtagaaaagataaccactcttatggtcttgaatct
tcaaataatgattttttgtataacccttgtcaaagatataaatcctcagtggaagaaatg
agggacggttgcagcgtttctaagggggatgcttgcccacagtcagttgatttgagagca
gagtccatgaaatgtactgttagcctatcaccactcagcagcactgaaggagagtacgca
gtctctgcaagcagcgttttaccatttccagcaaaaaaagatggcatggacaccatctgt
gaagatgaaagtatgttagatgaatcatcaaaacaaaatgagaaagaacctgaggttgac
tgcatgaccttcccaagtaacttggcattctctgcagacaatgcaagtacaggtgatccc
agagatgatttgcatagttcagactggctgcaagattttgatgctttattgggtaagaca
gtctacatcaataaagcaacgggactgagcacctacaacactcctcctgaagagtttcca
gctgcctgcattaaagatttaacaacaatggctgtgaacgttgtctcagagaatgggttt
cagtgcaggtgccatccctttagaagtgagactgtgctacccttccttcctagacctcga
aaagagaagactctagcaagccaggatcagagaggtggtgaaggtgagtctctgcagtcg
atgctttcagaatgggataatcctgtttttgttcgctgcccagagatagctgttgatgtg
accagtggtcaggctgagaatcttgctgtgaaaattcataatgttttgtatccttatcgt
tttaccaaagacatgattcattcaatgcaggttcttcagcaagtggacaataaatttatt
gcttgtgtaatcaacactaggaatgaaatggataaaaaggaaggtggaaacctcttggtt
ttggtggaccaacatgcagctcatgaacggatccgcctggagcagcttattgcagattcc
tacgataaggaggctacagcgtgcggcaagaagaaattactgtcttcctctgtctctccc
cctttagagattgaagttacagaagagcaaagaagaattctctggtgctgctacaaaaac
ttgaaggatctgggccttgagttatcatttcctgagaccaacagctccatgattctagtg
aagaaagtgccactgtgttttatagaaagagaggccaatgaactacgacggaagagacaa
cctgtcactaaaagcattgtggaggagcttattcaagaacaagttgagctagtgcagacc
atgagaggagcacaagggacactgcctctgacatttctgaaggtgttagcttcccaagcc
tgtcacggagctattaagtttaacgacagtttgacttcagaggagagctgtcggctcatg
gaagctttgtcatcttgccagctgcccttccagtgtgctcatggaagaccttccatgatg
ccccttgcagatattgaccatctccaggaggaaatgcagcctaaacctaacttggctaga
ctgcggaaaatggtgagagcatggcaactgtttggaaacaaagaccctaaccaaaaaagg
taa

DBGET integrated database retrieval system