KEGG   Gallus gallus (chicken): 100859279
Entry
100859279         CDS       T01006                                 
Symbol
FEZF1
Name
(RefSeq) fez family zinc finger protein 1
  KO
K24502  Fez family zinc finger protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100859279 (FEZF1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100859279 (FEZF1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-Di19 zf-Sec23_Sec24 zf-AN1 zf-BED
Other DBs
NCBI-GeneID: 100859279
NCBI-ProteinID: XP_003640395
CGNC: 66089
Ensembl: ENSGALG00000008941
Position
1:22978974..22982160
AA seq 449 aa
MDNSGHHTATKILAAPPARESLSARSTMIGTPKPLAFSIERIMARTPEPRSVPVPQLLHG
SAAKGDAKHPLHLGSSIPCMIPFVPVAYDPLGKAAGAEPRKAPLDSSSSPSFSCGDLLNC
ALSLKGDFPRDALPLQQYKLVRPRVVNHSSFHAMGALCYFNRGDGPCHPASGVNIHPVAS
YFLSSPLQPQPKAYLAERNKLVLPPADKFPAGVAFKDLSQAQLQHYMKESAQILSEKIAY
KSAEFGRGSPSSKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTL
CRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHK
LTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLH
DSAMGLPRPPAELGGPDPPPPLLPGPAQP
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggacaatagtggccatcacacggcgaccaaaatcctcgcggctcctccggcgagagaa
agcctttctgcgaggagcaccatgatcggcactcccaagcccctcgccttctccatcgag
cgcatcatggcgcggacgcccgagccccgctccgtgcccgtcccgcagctcctgcacggc
tccgcggccaagggcgacgccaagcacccgctgcatctcggctcctccatcccctgcatg
atccccttcgtgccggtggcgtacgaccccctgggcaaagcggcgggcgcggagcccagg
aaggcgcccttggactcctcttcctcgccctccttcagctgcggcgatctcttgaactgt
gccctgagcctgaaaggagatttcccccgcgacgccctgcccttgcagcagtacaaactg
gtaagaccccgagtggtcaatcactcctccttccacgccatgggagccctgtgctatttc
aaccgaggcgacggcccctgtcacccggcctccggtgtcaacatccacccggtggcttct
tatttcctcagctccccgctgcagccgcagcccaaggcgtacctggcggagcggaacaag
ctggtgctgccgcccgccgacaagttccccgccggggtggccttcaaggacttgtcgcag
gcgcagctgcagcattacatgaaggagagcgcccagatcctctcggaaaagatcgcctac
aagagcgcggagttcggccgcggctcgccgagcagcaagcccaaagttttcacgtgcgaa
gtttgcggaaaggtattcaatgcacactataacctaactcgccacatgccggtgcacacg
ggagccagacccttcgtttgcaaagtttgcgggaagggcttcaggcaggcgagcacgctg
tgccgccacaagatcattcacacgcaggagaagccccacaagtgcaaccagtgcggcaaa
gccttcaaccgaagctcgaccctgaacacgcacacgcggatccacgccggctacaaaccc
tttgtctgtgaattctgtggcaaagggtttcaccagaaaggcaactacaaaaaccacaag
ctgacccacagcggggagaagcaattcaagtgcaatatctgcaacaaggctttccaccag
gtgtacaacctcaccttccacatgcacacccacaacgacaagaagcccttcacctgcccc
acctgcggcaaaggcttctgccggaactttgacctcaagaagcacgtccgcaagctgcac
gacagcgccatggggctgccccgacccccggccgagctgggcggccccgacccgccgccc
ccgctgctcccgggccccgcgcagccctga

DBGET integrated database retrieval system