KEGG   Gallus gallus (chicken): 100859322
Entry
100859322         CDS       T01006                                 

Gene name
TAAR2
Definition
(RefSeq) trace amine-associated receptor 2
  KO
K05051  trace amine associated receptor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100859322 (TAAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    100859322 (TAAR2)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    100859322 (TAAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 100859322
NCBI-ProteinID: XP_003641016
CGNC: 66153
Ensembl: ENSGALG00000012040
UniProt: E1C0A1
Position
3
AA seq 342 aa
MFSMNISRDFTDCSEFGNRSCSDSSRSPGVRGVLYFSIAAAFLVTVSGNMAIIFSILYFK
QLHSPTNFLILSMAVTDFLLGFAIMPYSMVRSVENCWYFGMMFCKIHYSFDLMLCLVSIF
HLCSIAVDRFYAICHPLHYASTMTMAAIKQITAVCWSVPAVFAFGVVFSEAHASGIEGYE
SLVKCSSLCPIMFNKAWGIVLFTIGLFAPACIMLGIYIKIFVVSQKHIRVLSQTHKHRKS
DMKNELSKSKDKKAAKTLSVVMLAFLVCWFPCFFAILLDPFLNFSIPSPLFDALNWFGYL
NSTCNPLIYGFFYPWFRKAFKYIVTGKIFNPQLRTTKLSSED
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgttttccatgaacatctcgagagattttactgactgctctgagtttggaaataggtcc
tgttctgacagctctaggtcacccggagtacgaggggtattgtatttctccatagctgca
gccttccttgtcaccgtctcagggaatatggccataattttttccatcttgtatttcaaa
cagcttcattccccaactaattttctcatcttatccatggccgtcacggatttcctgttg
ggctttgccattatgccctacagcatggtgaggtctgtggagaactgctggtattttggg
atgatgttctgcaaaattcattacagttttgacctgatgctctgcttagtttcaattttc
catctttgttccattgcagtggatcgtttttatgcaatctgccaccctctgcattatgcc
agcacaatgaccatggctgccataaaacaaataacagcagtgtgttggtcagtgccagct
gtatttgcttttggtgttgttttctcagaagctcatgcttctggaattgagggctatgaa
agtttggtcaaatgctcaagcttgtgccctattatgttcaacaaagcgtgggggattgtt
ttatttacaattggtctatttgctcctgcttgtattatgttagggatctacattaaaatt
tttgtagtctcccaaaagcacatacgtgtgttgagccagacacacaagcacagaaaaagt
gatatgaaaaatgaactttctaagagtaaagacaagaaagctgccaagaccttgagtgta
gttatgttggctttcttagtatgctggtttccttgcttttttgctatcctacttgatcca
ttcttaaatttctctattccttcccctttatttgatgctctaaactggtttggttactta
aattctacctgtaatccattaatatatggctttttctacccatggtttcggaaagcattt
aaatatattgtaacaggcaaaatattcaacccccaacttcgtacaactaaactttcatct
gaagattag

DBGET integrated database retrieval system