KEGG   Gallus gallus (chicken): 100859435
Entry
100859435         CDS       T01006                                 

Gene name
EN2
Definition
(RefSeq) homeobox protein engrailed-2
  KO
K09319  homeobox protein engrailed
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100859435 (EN2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, En
    100859435 (EN2)
SSDB
Motif
Pfam: Homeodomain Engrail_1_C_sig Homeobox_KN CENP-B_N DUF2316
Other DBs
NCBI-GeneID: 100859435
NCBI-ProteinID: NP_001254648
CGNC: 63707
Ensembl: ENSGALG00000036560
UniProt: Q05917
Structure
PDB: 
3ZOB

Position
2
AA seq 289 aa
MEEGGRSPREEAAEPQESGGDAEPGGGRRALLLPPGDPPHPHPHPHRITNFFIDNILRPE
FGRRKEAGGTAGEPRRPGAESRRSPAAAAPAPGAPVPGGGGGGGGGSPGRGEGGPAALAL
HGAAKKGGDPAALEAALKARGLSGAELSVSSDSDSSQAGSNAGNQPMLWPAWVYCTRYSD
RPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELGLN
ESQIKIWFQNKRAKIKKATGSKNSLAVHLMAQGLYNHSTTAKDGKSDSE
NT seq 870 nt   +upstreamnt  +downstreamnt
atggaggagggcggccgcagcccccgggaggaggcggccgaaccgcaggagtccggcggg
gacgcggaacccggcggagggcgtcgggctctgctgctgccccccggcgaccccccgcac
ccccacccgcaccctcaccgcatcaccaacttcttcatcgacaacatcctgaggcccgag
ttcggtcggaggaaggaagcgggaggaaccgccggagaaccccgcaggcccggagcggag
agcaggaggagccccgcggccgccgcgcccgctcccggagctccggtgcccggcggagga
ggcggcggcgggggtggatcgccgggccgaggggagggcggccccgccgctctggccctg
cacggagcggccaagaaggggggagaccccgcggcgctggaggcggccctgaaagcgcgg
gggctgagcggcgcggagctgtcggtgagctcggactcggatagctcccaggccggctcc
aacgccgggaaccaacccatgctttggcccgcttgggtgtactgcacgcggtactcggac
cgaccgtcttcaggtccccgctcccgcaaaccaaagaagaagaaccccaacaaggaagac
aagcggccccgcaccgccttcacggccgagcagctgcagagactcaaggccgagttccag
acgaaccgctacctgacggagcagcgccggcagagcctggcccaggagctcggcctcaac
gagtcccagatcaagatctggttccagaacaagagagccaagatcaagaaggcgacgggc
agcaagaactcgctggcggtgcacctcatggcccaggggctctacaaccactccaccacg
gcgaaagacggcaagtcggacagcgaatag

DBGET integrated database retrieval system