KEGG   Gallus gallus (chicken): 100859557
Entry
100859557         CDS       T01006                                 

Gene name
NCAPG2
Definition
(RefSeq) condensin-2 complex subunit G2
  KO
K11492  condensin-2 complex subunit G2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    100859557 (NCAPG2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin II
    100859557 (NCAPG2)
SSDB
Motif
Pfam: Condensin2nSMC Adaptin_N Cnd1 HEAT_2 DUF577 Vac14_Fab1_bd TIP120 PPR_1 PPR
Other DBs
NCBI-GeneID: 100859557
NCBI-ProteinID: XP_003640726
CGNC: 63585
Ensembl: ENSGALG00000006525
UniProt: F1NWM5
Position
2
AA seq 1144 aa
MKREAFLQAVSKKSVEDFLRFTQISKDTFDPFNLNELLQELSRKQKEILWERLRHLLKET
LMEKPVETWQRVEDAESNDGMEVESAPEMKQTVAVIQGVTAVVTASIPVVDETVNYKALL
ECAFILNGIIPALPESENILRSAIRRVCEMWWEKGLEGKEQLGKTAFIMLLKKSLSKAAT
GVDIVCLWKLHQTLLCFDYDSEDSNEIKDLLLQCFMSVKHIKKEEGRRILSFFFSWNVNF
IKMIHGTVKNQLQFFPRSLVEYISEIYFRAWKKVSGETLEILEHNCIQDFMHHGIHLPRS
SSVYSKVREMLSYFHKQSKVRQGVEEMLYRLYKPILWRALKARNSEVRSNAAFLFIDAFP
IRDPSFNTEEMDAEIQKQFEELFSLLEDPHPVVRSTGILGVSQITSKYWEMIPPTVIADL
LKKLIEELACDVTSADVRCSVFKCLPITLDNKLSHPLLEQLLPTVKHSLHDNSEKVRVAF
VDMLLKVKATKAAKFWKICPMEHLLARLEVDSRPVSRRIVNLLFNSFLPVNQPEDVWCER
CVTLIQMNPAAARKFYQYAYEYTAPTNIAKLMLTIRRCLNACIQKAVKESFGDDGEDEGE
KENLSVLNDVLSINDVASMASLLEITVILWRSIHKALDHNEDAKDYTIRKFASVLPEYLK
VFKDDRCITPLVILASFMPPAAIPTFSCGVISKLRSIDSGADQSKYSTLIDCMCRWGRVG
HVLELACDWLSDMLTPRKNVKTSERRVRIHVTHESKPELALDYIEYLLTHPVNRGCLLSV
PKKKLNHLLKVLSAAKEILGSVLKTTDTNRGSCSQGTGLRAFSLCCRLSIHLQNKFSEEG
KDYLSHLQETGAWVESHVLPFILASEQEDGISKQSNVPELIIQAYLSVCKDVIMVGLGNV
KFQLYFLDMALSVIQTARGAFCTPVLLCALKEITEASLTQSTEVDEVANVLHAVQTIFQK
VLECVASRIKEQPGEGIQLIQSIQTPLGDFLHAVQCWHSFCPAVHQSVFSTLLAAILAEI
KYALQEASSEKAFTIPRTVSDLPPLSSSLMAIIMKSVNVVRSFLNELLECILSEEIEGIF
SLTSMVCTVIVIKGKHKTSLLKDVAPVIQRKLITYKEAATEESSSTERILYESSQKILDE
LLNP
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgaaacgtgaagcgtttttacaagctgtgtctaaaaagtcagttgaggacttcttgcgt
tttactcaaatttctaaagatacatttgatcctttcaatttgaatgaattacttcaagaa
ttgtcaagaaaacaaaaagaaatactatgggagagactgagacacctattgaaggagacc
ttgatggagaaacctgtggaaacatggcaacgggtagaagatgctgaaagtaatgatggc
atggaagttgagagtgctccagaaatgaaacaaactgtagctgtgatccaaggagtgaca
gctgtagttactgcttccatacccgtagtggatgaaacagtgaactacaaagctcttcta
gaatgtgcctttatattaaatggtattattcctgcattacctgaatctgaaaatatccta
cggagtgccatccggcgtgtatgtgaaatgtggtgggagaaaggactggaaggaaaggag
cagctagggaaaacagcatttattatgctgctgaaaaaaagcctgagtaaagctgctacg
ggtgtagacatcgtttgtctatggaaactacatcagaccttactttgttttgattatgat
tcagaggacagtaatgaaatcaaagacctgttacttcagtgttttatgagcgtaaagcac
atcaaaaaagaagagggaagaagaattttgagctttttcttcagctggaatgtcaacttc
attaaaatgatacatggaactgttaagaaccaattacagttttttccaagatccttggtg
gaatacatttcagaaatatacttcagagcatggaagaaggtgtcaggagaaactttagag
atacttgaacacaattgtattcaggatttcatgcaccatggaattcatcttcccagaagt
tcttctgtttattctaaagttagagagatgctgagttattttcataaacaaagtaaagtt
cgtcaaggagttgaagaaatgctctatcgattgtataaacctatcctttggagagcactg
aaggcaagaaactcagaagttcgatcaaatgcagcatttttgtttattgatgcttttcct
attcgtgatcctagttttaacactgaagagatggatgctgaaattcagaaacaatttgaa
gaactttttagcctcttggaagatcctcatccagttgtccgatctacagggatacttgga
gttagtcagataacatccaaatactgggagatgattcctccaacagttattgctgatctt
ttaaaaaagctaattgaagagctggcgtgtgatgtaacatctgctgatgttcgatgctct
gtttttaaatgtctaccgataactttggacaacaaattaagtcatccgttactggagcag
ctcctgccaacagttaaacacagccttcatgacaattcagagaaagtgcgagtggctttt
gtagatatgctgctgaaagttaaggctactaaggcagcaaagttctggaagatctgtcct
atggagcatcttctggctcgcttggaggttgattcgcggcccgtgtcgcggcgcatagtg
aatctcttattcaactccttcctgcccgttaaccagcccgaggatgtgtggtgtgaacgc
tgtgttactttaatccagatgaatccagcagcagctcgaaagttctatcaatatgcttat
gagtatactgcccccaccaatatagctaaactgatgctaactattcgacgctgcttgaat
gcctgcatccagaaagcagtgaaagagagttttggtgatgatggtgaagatgaaggtgaa
aaggagaacctaagtgtgttgaatgatgtgttgtcaataaatgatgtggccagcatggca
agtttattggagattacggtgattctctggagaagtattcacaaagcgttggaccacaat
gaagatgccaaagattacaccatcagaaaatttgcttctgtacttcctgagtatttaaaa
gtatttaaggatgaccgttgcataactccattggttattctggcatcctttatgccccct
gctgctattcctactttcagctgtggtgtgatctccaaactcagaagcattgacagtgga
gctgaccaaagcaaatactctaccctgatagactgtatgtgtcgctggggtcgagttggt
catgtgttggaattggcctgtgactggttgtcagacatgctaaccccaagaaagaatgtt
aaaacatcggaacggcgagtacgtatccacgtgacacatgaatcgaagccagaattagca
cttgattacattgaatatttattgactcatcctgttaaccgtggttgcctactctctgtt
cctaaaaagaaactgaaccatcttctgaaagttctcagtgctgctaaggagattcttggc
tcagttctgaaaacaactgatacaaatcgtggtagctgcagtcaaggaactggcttaaga
gccttcagcctgtgttgcaggttgagtattcatcttcaaaacaagttttctgaagaagga
aaagattatctgtcacatctgcaggagacaggggcttgggtagaaagtcacgttttacct
tttatacttgcatctgaacaagaggatggaatttcaaaacagagtaatgttcctgaatta
attatccaggcctatctgtcagtctgcaaagatgtcataatggttggtcttggaaatgtc
aagtttcaactgtactttttagatatggcactttcagttatacaaacagccaggggtgcc
ttttgtacaccagtactattgtgtgcactaaaagaaattactgaagcttctctgacccag
agcactgaggtggatgaagtagcaaatgtcctccatgctgtacagaccatcttccagaag
gttttagaatgtgttgcaagcagaatcaaggagcagcctggagaagggattcagttgatt
cagtcaattcaaacacctcttggagatttcttacatgcagtccagtgctggcattcattt
tgcccggcagttcaccagagtgtgttctccactctcctagctgcaatactggcagagata
aagtatgcgctacaggaggcttccagtgaaaaagctttcactataccaaggacagtttca
gaccttccgcctctttcaagcagcttaatggcaataattatgaagtctgttaatgtggtc
aggtcatttttaaatgaattactggaatgcattctatcagaagaaattgaagggattttt
agtcttacatctatggtctgcactgtgattgtaattaaaggtaagcacaaaacttcactt
ctaaaagatgttgcacctgtcattcagagaaagcttataacctacaaggaagctgccaca
gaagaatctagcagtactgaaagaattctgtatgaatcatctcagaaaattttggatgaa
cttctgaatccttga

DBGET integrated database retrieval system