KEGG   Gallus gallus (chicken): 100859605
Entry
100859605         CDS       T01006                                 

Gene name
MPZ
Definition
(RefSeq) myelin protein P0 isoform MPZ precursor
  KO
K06770  myelin protein zero
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100859605 (MPZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    100859605 (MPZ)
Cell adhesion molecules [BR:gga04515]
 Immunoglobulin superfamily
  P0
   100859605 (MPZ)
SSDB
Motif
Pfam: Myelin-PO_C V-set ig Ig_2 Ig_3 I-set Herpes_gE Amnionless Tweety
Other DBs
NCBI-GeneID: 100859605
NCBI-ProteinID: NP_001345858
CGNC: 63541
Position
25
AA seq 249 aa
MALGAIGDGRLLLLLVGLLSASGPSPTLAIHVYTPREVYGTVGSHVTLSCSFWSSEWISE
DISITWHFQAEGSRDSISIFHYAKGQPYIDDVGSFKERMEWVGNPRRKDGSIVIHNLDYT
DNGTFTCDVKNPPDIVGKSSQVTLYVLEKVPTRYGVVLGSIIGGALLLVALLVAVVYLLR
FCWLRRQAVLQRRLSAMEKGKLQRSAKDASKRSRQPPVLYAMLDHSRSAKAAAEKKSKGA
PGEARKDKK
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcgctgggtgccatcggggacggccgcctcctcctcctccttgtggggctgctgtcg
gcgtcggggccatcccccacgttggccatccacgtgtacacaccgcgggaggtgtacggc
accgtgggctcccacgtcaccctctcgtgcagcttctggtccagcgagtggatctcggag
gacatctccatcacgtggcacttccaggccgagggcagccgtgacagcatctccatattc
cactacgccaaaggccaaccctacatcgatgacgtgggatccttcaaggaacgcatggag
tgggtggggaacccccggcggaaggacggctccatcgtcatccacaacctggactacacc
gacaacggcaccttcacgtgcgacgtcaaaaacccccccgacatcgtggggaaatcctcc
caggtcacactctacgtcttagagaaagtgcccacgcgttacggcgtcgttttgggctcc
atcatcggcggcgccctcctgctggtggctctgctggtggctgtggtttacctgctgcgc
ttctgctggctgcgcaggcaggcggtgctgcagaggcggctgagcgccatggagaagggg
aagctgcagaggtcggccaaggacgcgtccaagcgcagccggcagcctcccgtgctttac
gccatgctggatcacagccgcagcgccaaagcggccgccgagaagaaaagcaaaggagct
ccgggtgaagcccgcaaggacaagaaatag

DBGET integrated database retrieval system