KEGG   Gallus gallus (chicken): 100859721
Entry
100859721         CDS       T01006                                 

Gene name
APOC3
Definition
(RefSeq) apolipoprotein C-III precursor
  KO
K08759  apolipoprotein C-III
Organism
gga  Gallus gallus (chicken)
Pathway
gga03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100859721 (APOC3)
SSDB
Motif
Pfam: Apo-CIII ApoC-I ApoLp-III Peptidase_S49_N FANCI_HD1 CCDC-167 Uteroglobin DUF4972 YtxH Sec16 XendoU DUF5320
Other DBs
NCBI-GeneID: 100859721
NCBI-ProteinID: NP_001289056
CGNC: 63428
Ensembl: ENSGALG00000030920
UniProt: A0A1D5PK48
Position
24
AA seq 93 aa
MKVSILLLLICTAILAVGARAEAPDKTEVVVKKVQEYVKQATEAVKTAFTTVHESEAAQQ
ARKWLSDNADLVKQQLAKLKEQLAELWKLTPTA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaggtctccatcctgctcctgctcatctgcacggccatcctggcggtgggagcgcgg
gccgaagctcccgataagacagaagtggtggtgaagaaggtgcaggagtacgtcaagcaa
gccactgaggcagtcaagacggccttcaccacagtgcatgagtcagaggcagctcagcaa
gccaggaaatggctgtcagacaacgccgacctggtgaagcagcagctggcaaagctgaag
gagcagctggccgagctctggaagctgacgccgaccgcgtag

DBGET integrated database retrieval system