KEGG   Gallus gallus (chicken): 100859744
Entry
100859744         CDS       T01006                                 

Gene name
RASGEF1B
Definition
(RefSeq) ras-GEF domain-containing family member 1B isoform X3
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: RasGEF RasGEF_N RNase_H2-Ydr279 LMP
Other DBs
NCBI-GeneID: 100859744
NCBI-ProteinID: XP_004941151
CGNC: 63405
UniProt: A0A3Q2U7F8
Position
4
AA seq 472 aa
MPQTPPFAAMFDSSGYNRNLYQSKEDGCGGLYYHDNNLLSGSLEALIQHLVPSVDYYPDR
TYIFTFLLSSRLFMHPYELMAKVCHLCIEQQRLSEPVQDKNRIRKIAPKILQLLTEWTET
FPYDFRDERMMRNLKELAQRITSGDEMYRKNVQQLLQNLLRKLATVSQYEEVLAKINATS
TDRLTVLKTKPQSIQRDIITVCNDPYTLAQQLTHIELERLNYIGPEEFVQAFVQKDPLDN
DKSCYGDRKKSRNLEAYVEWFNRLSYLVATEICMPVKKKHRARVIEYFIDVARECFNIGN
FNSLMAIISGMNMSPVSRLKKTWAKVKTAKFDILEHQMDPSSNFYNYRTALRGATQRSLT
AHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFWELAKQVSEFMTWKQVECP
FERDRKILQYLLTIPVFSDDALYLASYESESPENHIEKDRWKTLRSTLLGRV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgccacagacacctccctttgcagcaatgtttgacagcagcggctacaacaggaatctg
tatcagtcaaaagaggatggctgtggaggactctattaccacgataacaacctcttgtca
gggtctctggaagctctgatccagcatttagtgcccagtgtagattattatcctgatagg
acatacatcttcaccttccttctcagttcacgcttgttcatgcatccctatgagcttatg
gccaaagtttgccatctgtgcattgagcaacagagactaagtgagcctgtccaggacaag
aaccgaatacgaaaaatagctcccaaaatcctgcagctcttgacagaatggacagagaca
tttccttatgattttcgagatgaaagaatgatgagaaacttaaaggagttggcacaaaga
ataaccagtggtgatgagatgtatcggaagaacgtccagcagctcctccagaacctgctt
cgaaagctcgcaactgttagccagtatgaggaagtacttgcaaaaatcaatgcaacgtcc
acagatcgcctcacagtcctaaagaccaagccacagtccatccagagggacataatcact
gtctgcaatgatccctacacattagctcagcagctgacacacatagagctcgaaagactt
aattatatcgggccagaagaatttgtccaggcttttgtacaaaaggatcctttggataat
gacaagagctgctacggagatcgaaagaagagccgtaacctggaagcatatgtggaatgg
tttaacaggctcagttacttggttgcaacagaaatctgtatgcccgtgaaaaagaagcac
agagcaagagtgatagaatatttcattgatgtggcacgggaatgttttaacattgggaac
tttaactccttaatggctattatttctggcatgaacatgagtcctgtctctcgattaaag
aaaacatgggcaaaagtgaagactgccaaatttgatattcttgagcatcagatggaccct
tctagcaatttttataattaccggactgctctgcgtggagccacccaaaggtccttgaca
gctcatagcagcagagagaagattgtgataccgttcttcagcctcttgatcaaagatatt
tacttcctcaatgaaggctgtgccaatcgtcttccaaacggtcatgtcaattttgagaag
ttttgggaattggcaaaacaagtcagtgaatttatgacatggaagcaagtggagtgtcca
tttgaaagggatcggaagattctgcagtatttgctcactatcccagtctttagtgatgat
gcactttacttggcttcctatgagagtgaaagtcctgagaatcacattgagaaggacaga
tggaagactctgaggtcaacgcttctgggcagagtctaa

DBGET integrated database retrieval system