KEGG   Gallus gallus (chicken): 100859842
Entry
100859842         CDS       T01006                                 

Symbol
LAMTOR2
Name
(RefSeq) ragulator complex protein LAMTOR2
  KO
K20398  ragulator complex protein LAMTOR2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100859842 (LAMTOR2)
SSDB
Motif
Pfam: Robl_LC7
Other DBs
NCBI-GeneID: 100859842
NCBI-ProteinID: XP_015153829
CGNC: 63316
Ensembl: ENSGALG00000029881
Position
25:1550742..1553389
AA seq 125 aa
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWVAYDKNG
HHAFNEDNLRFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLT
QVAAS
NT seq 378 nt   +upstreamnt  +downstreamnt
atgctgcggcccaaagcgctgacgcaggtgctgagccaggccaacaccggcggcgtccag
agcacgctgctgctgaacaatgagggctccctcctggcctactcgggctacggggacacg
gacgcccgcgtgacggcggccatcgccagcaacatctgggtggcgtacgacaagaacggg
caccacgccttcaacgaggacaacctccgcttcatcctcatggactgcatggagggacgc
gtggccatcacccgcgtggcgaacctcctgctgtgcatgtatgccaaggagacggtcggc
tttgggatgctgaaagccaaggcgcaggcgctggtgcagtacctggaggagccgctgacg
caggtggccgcatcctga

DBGET integrated database retrieval system