KEGG   Gallus gallus (chicken): 101747811
Entry
101747811         CDS       T01006                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101747811 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101747811 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 101747811
NCBI-ProteinID: XP_015133872
CGNC: 67304
Position
4
AA seq 120 aa
MTGRARGRAGLSPPTNAAIPERGHRLLRVRVPARPCPRAGRSMAARRWLLALLLLFCLAL
SAASAGPLGAGLDGMDPEDGLIRTLVRPRGARRGNVRRPGGWRRLRRPRPRLSHKGPMPF
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaccgggcgggcgcggggccgggccgggctctcaccgcctacaaatgcggcgatcccg
gagcggggccaccgcctcctgcgtgtccgtgtccccgcgcgtccgtgtccccgcgccggg
cggagcatggcggcgcgccgctggctgctggcgctgctgctgctcttctgcctcgcgctg
agcgccgcgtccgcgggtccgctgggagcggggctggacgggatggatcccgaggacggc
ctcatccgaacgctggtgcggccccgaggtgcgcggcgtgggaacgtgcggcggccggga
gggtggcggaggctccgccgtccccggccacggctgtcccataagggccccatgcccttc
tga

DBGET integrated database retrieval system