KEGG   Gallus gallus (chicken): 107049063
Entry
107049063         CDS       T01006                                 

Gene name
POLR2J
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB11-a
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
gga  Gallus gallus (chicken)
Pathway
gga03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    107049063 (POLR2J)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    107049063 (POLR2J)
   03400 DNA repair and recombination proteins [BR:gga03400]
    107049063 (POLR2J)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     107049063 (POLR2J)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      107049063 (POLR2J)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L SHNi-TPR
Other DBs
NCBI-GeneID: 107049063
NCBI-ProteinID: XP_015151491
CGNC: 66736
Ensembl: ENSGALG00000030808
UniProt: A0A1D5NWZ8
Position
19
AA seq 117 aa
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaacgctcctccggccttcgagtcgttccttctcttcgaaggcgagaaaaagatcacc
atcaacaaggacaccaaggtgcccaacgcctgcctgttcaccatcaacaaggaggaccac
acgctggggaacatcatcaagtcgcagttactgaaggaccctcaggtgttgtttgcaggg
tacaaagtcccacaccccctggaacacaaaatcatcatccgagtccaaacgacaccagat
tacagcccccaggaggccttcaccaacgccatcacggatctgatcagtgagctgtccctc
ctggaggagagattcagggttgccatcaaagacaaacaggaaggaatcgagtaa

DBGET integrated database retrieval system