KEGG   Gallus gallus (chicken): 107049913Help
Entry
107049913         CDS       T01006                                 

Definition
(RefSeq) zinc finger protein 646-like
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107049913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gga01007]
    107049913
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gga03016]
    107049913
Enzymes [BR:gga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     107049913
Amino acid related enzymes [BR:gga01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107049913
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    107049913
 Prokaryotic type
    107049913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1 zf-C2H2_4 zf-C2H2_jaz zf-C2H2 zf-C2H2_6 zf-C2HE Anticodon_1 zf-met TFIIA zf-H2C2_2 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 107049913
NCBI-ProteinID: XP_025001294
CGNC: 72929
Position
33
AA seq 809 aa AA seqDB search
MALRNHARLHRRRPPPPKPPVPPQRLFGCEVCGKAYLHSGSLINHRRTHQTGDFGCHLCP
KRFSNVAALKGHLRRHSRRCRRHHRARMGAGNACLVCLEERGAAEGRGGREEDEEEEEDE
EEEEEEEGRPAARDGGAPGSAVGPGGSAGCSEDLPSPHICGSCGQPFDNMDALREHCRRH
RAEQQAAVAAVPASAERRPYACGVCGKTYRHGGSLVNHRQTHQTGVFPCMVCARWYPNMA
AYRNHLRNHPRCKAGLPAAPSPIGFVEEEEEEGRRRQQLATRQQSAARQQLGVKQPPGMQ
RQQTGVRQQPVMQQQQQPGMQQQQSEMQQQQPGMQQQQPGMQQQQPGMQQQQPGMQQQQS
EVQQQPSTRPFRCEECGRSYKHAGSLVNHRHSHTTGLFRCSACHKAFYNLMALKNHRRTH
AERRCGLCPKDFRLREQLAGRLNQQADGAVGVSPPGGDPPDPPGLWVVARSEDEARDEAA
RLCRVPPKDIELQQDPDVLDTWFSSALFPFAALGWPEETPDLRRFYPTTLLETGSDLLFF
WVARMAMLGQELTGRLPFSQVLLHSLVRDAAGRKMSKSLGNVIDPRDVIGGASLQELQEK
LHRTILDPHELAVASEGQKRQFPHGIPECGTDALRLALCSHNVHGDDIRLDVASVLNQRH
FCNKVWNAVKFVLAALGPHFTPQPPEETSPHAPMDRWVLSRLARAVGDFGRRMEALEVHG
ATAAAQHFWLRSFCDVYLVGGVSVCPSVRLSVLPSVAYLLPRALRPSTSISCVSLALSLL
DRVRLSVPFIADFCLLRPSVRPTHPVASP
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atggccctccgcaaccacgccaggcttcaccgccgccgcccaccccccccgaaacccccc
gtcccccctcaaaggctcttcggctgcgaggtgtgcggcaaagcctacctgcactccggg
agcctcatcaaccaccgcaggacccaccagacgggggatttcggctgccacctctgcccc
aaacgcttctccaacgtggccgccctcaaaggacacctccggaggcacagccggcgctgt
cggcgtcaccaccgggccaggatgggagccggcaacgcgtgtttggtgtgcctggaggag
aggggggctgcggaggggagagggggaagagaggaggacgaggaggaggaggaggacgag
gaggaagaggaggaggaggaaggacggccggcagcgcgggacggcggagcccccgggagc
gccgtgggaccgggagggtctgctgggtgctcggaggacctcccgtcgccccacatctgt
gggtcgtgcgggcagcccttcgacaacatggacgccctccgggagcactgccggcgtcac
cgcgccgagcaacaggcggccgtggcggctgtgccggcgtcagcggagcgccgtccgtac
gcctgcggggtgtgcgggaagacctacaggcacggggggagtctggtgaaccaccgtcag
acgcaccagacgggtgttttcccctgcatggtgtgcgcgcggtggtaccccaacatggcc
gcctaccgcaaccacctccgcaaccacccgcggtgtaaagccgggctgccggcggcgccg
tcgcccattggcttcgtggaggaggaggaggaggaagggaggaggaggcagcagttggcg
acgaggcaacagtcggccgcgaggcaacagctgggggtgaagcaaccgccggggatgcag
cggcaacagactggggtgaggcaacagccggtgatgcagcagcagcagcagcctgggatg
cagcagcaacagtcggagatgcaacaacaacagcctgggatgcaacaacaacagcctggg
atgcaacaacaacagcctgggatgcaacaacaacagcctgggatgcagcagcaacagtcg
gaggtgcaacagcagccgtcgacgcggccgttccggtgcgaggagtgcggccggagctac
aaacacgctgggagtttggtgaaccatcggcacagccacaccaccgggctgttccgctgc
tccgcctgtcacaaggccttctacaacctgatggcgctgaagaaccaccggaggactcac
gccgagaggcggtgcgggctctgccccaaagactttcggctccgggaacagctggcgggg
aggctgaaccaacaggcggatggggccgtgggggtgtcgccccctggaggggaccccccc
gacccccccgggctctgggtggtggcacgcagcgaggacgaagcccgggacgaggctgcc
cgcctctgccgtgtcccccccaaggacatagagctgcagcaagaccccgacgtcctggac
acgtggttctcctccgctctcttccccttcgccgccctggggtggcccgaggagaccccc
gatctacgccgcttctaccccacaaccctactggagacgggcagcgatctgctcttcttc
tgggtcgcacgcatggccatgctgggacaggagctcaccgggcgcctccccttctcccag
gtgctgctgcattcattggtgcgtgacgcggcggggaggaagatgagcaaatcgctgggg
aacgtcattgacccccgggatgtgattgggggggcgtcgcttcaggagctgcaggagaaa
ctgcaccgcaccatcctggacccccatgagctggcagtggcctcagaggggcagaagcgc
cagttcccccacggcatccccgaatgcggcaccgacgccctccgcttggcgctgtgctcc
cacaatgtccacggtgacgacatccgcctggacgtggcctccgtgctgaaccaacgccac
ttctgcaacaaagtctggaacgccgtcaagttcgtcctggccgccctcggcccccacttc
accccccagccccccgaggagacatccccgcacgctcccatggaccggtgggtgctgagc
cgcctggcgcgggcggtgggcgattttgggaggaggatggaagctctggaggttcacggg
gccacggctgctgcacagcacttctggctcaggtccttctgcgacgtctatttggtgggt
ggcgtgtccgtctgtccgtccgtccgtctgtccgtccttccttcggttgcctatcttctg
ccccgggcgttgcgtccgtccacctccatctcttgcgtctcgttggcgttgagcctgctt
gaccgtgtccgtctgtccgtcccgttcattgctgacttttgtctactgcgtccgtctgtc
cgtcctacccatcctgttgcatctccctga

DBGET integrated database retrieval system