KEGG   Gallus gallus (chicken): 107052471
Entry
107052471         CDS       T01006                                 

Gene name
LIPT2
Definition
(RefSeq) putative lipoyltransferase 2, mitochondrial
  KO
K23735  lipoyl(octanoyl) transferase 2 [EC:2.3.1.181]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00785  Lipoic acid metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    107052471 (LIPT2)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     107052471 (LIPT2)
SSDB
Motif
Pfam: BPL_LplA_LipB HCV_NS5a_1a
Other DBs
NCBI-GeneID: 107052471
NCBI-ProteinID: XP_015136505
CGNC: 75474
UniProt: A0A3Q3A5Q0
Position
1
AA seq 230 aa
MPAPAVRAVSLGLRPYEEALRVQQRCVAAARAARGPPPRPPSECVVLSEPARPVYAWGLR
GAPAEQEAERLRAAGAGLAAVRRGGSVTFHGPGQLLAFPVLDLKARGMPLRGFVERLQDV
AVRLCRRVGAMSAAGRPPPYTGVWVGDGKVCAVGVHCGNHITSHGLALNCCIDLSWFEHI
VPCGLEGTTATSLSRELGRHVTVEDILEPFLESFQEVFDCTVVFSEEPRD
NT seq 693 nt   +upstreamnt  +downstreamnt
atgccggctccggccgtgcgggcggtatcgttggggttgcggccttacgaggaagcgctg
cgggttcaacagcgctgcgtggcggctgcgcgggcggctcggggccctcctccgcgtccg
ccatccgagtgcgtggtgctgagcgaacccgcacggcccgtatacgcgtgggggctgcgg
ggagccccggccgagcaggaggcggagcggctgcgggcggcgggcgcggggttggcggcg
gtgcggaggggcggcagcgtgacgttccacgggcccgggcagctgttggccttccccgtg
ttggacctgaaggcgcgggggatgccgctgcggggcttcgtggagcggctgcaggacgtg
gcggtgcggctgtgccggagggtcggggcgatgagtgcagccgggcgaccaccgccgtac
accggagtgtgggtgggggacggcaaagtgtgcgccgtcggggtgcactgtgggaaccac
atcacctcccacgggctggcactgaactgctgcattgacctctcctggttcgagcacatc
gtgccctgtgggctggaggggacgacggccacttcactgagccgtgaattgggtcgccat
gtcaccgtcgaggacatcctcgagcccttccttgagtccttccaggaggtctttgactgc
actgtggtgttttctgaggagcccagggactga

DBGET integrated database retrieval system