KEGG   Gallus gallus (chicken): 107054146
Entry
107054146         CDS       T01006                                 

Gene name
SERP1
Definition
(RefSeq) stress-associated endoplasmic reticulum protein 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: RAMP4 DUF1206
Other DBs
NCBI-GeneID: 107054146
NCBI-ProteinID: XP_015147337
CGNC: 77130
Ensembl: ENSGALG00000037325
UniProt: A0A1D5PAC2
Position
9
AA seq 66 aa
MVAKQRIRMANEKHSKNITQRGNVAKTSRTAPEEKASVGPWLLALFIFVVCGSAIFQIIQ
SIRMGM
NT seq 201 nt   +upstreamnt  +downstreamnt
atggtggccaagcagcgcatccgcatggccaacgagaagcacagcaagaacatcacgcag
cgcgggaacgtcgccaagacctcgaggacggccccggaggagaaggcgtcggtcgggccc
tggctgctggcgctgttcattttcgtggtctgcggatcagccatcttccagatcatccag
agcatccgcatgggcatgtga

DBGET integrated database retrieval system