KEGG   Gallus gallus (chicken): 112529926
Entry
112529926         CDS       T01006                                 

Gene name
POLR2K
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC4
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
gga  Gallus gallus (chicken)
Pathway
gga03020  RNA polymerase
gga04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    112529926 (POLR2K)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    112529926 (POLR2K)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    112529926 (POLR2K)
   03400 DNA repair and recombination proteins [BR:gga03400]
    112529926 (POLR2K)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     112529926 (POLR2K)
  RNA polymerase III system
   RNA polymerase III
     112529926 (POLR2K)
  RNA polymerase I system
   RNA polymerase I
     112529926 (POLR2K)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      112529926 (POLR2K)
SSDB
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon MCM_OB Cytochrome_C7 DUF5816 DZR HypA zinc_ribbon_13
Other DBs
NCBI-GeneID: 112529926
NCBI-ProteinID: XP_015138451
CGNC: 54423
Position
2
AA seq 58 aa
MDSQKDVQPPKQQPMIYICGECHTENEIKARDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt   +upstreamnt  +downstreamnt
atggattcacagaaggatgttcagcctcccaagcagcagccaatgatttacatttgtgga
gaatgtcatacagaaaatgaaataaaagcaagagatccaatcagatgccgagaatgtggg
tacagaataatgtacaagaaaagaacaaaaagattggtggtttttgatgcccggtga

DBGET integrated database retrieval system