KEGG   Gallus gallus (chicken): 373893Help
Entry
373893            CDS       T01006                                 

Gene name
RAX2
Definition
(RefSeq) retinal homeobox protein Rx2
  KO
K09332  retina and anterior neural fold homeobox protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373893 (RAX2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    373893 (RAX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain OAR T6SS_TssF Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 373893
NCBI-ProteinID: NP_989435
CGNC: 48945
Ensembl: ENSGALG00000013431
UniProt: Q9PVY0
Position
28
AA seq 228 aa AA seqDB search
MFLNKCEGDLGELRKPGDSEGTPPAAAEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHY
PDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMEASSMKLHDTPMLSFNRPPMTAN
VGPMSNSLPLDPWLTSPISSATPVHSIPGFMGAPQALQPPYGGHSFLNTPPGMAQGMQPM
APAPYQCGTPFVDKYPLEDVDQRSSSIASLRMKAKEHIQTIDKTWQPI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcaataagtgtgagggggacctgggcgagctgcggaagccgggggacagcgag
gggacccctccagctgctgctgaggaggaacagcccaagaagaagcaccggcggaaccgc
accacgttcaccacctaccagctgcacgagctggagcgcgccttcgagaagtcccactac
cccgacgtgtacagccgcgaggagctggccatgaaggtcaacctgcccgaggtccgcgtg
caggtctggttccagaaccggcgagccaagtggaggcggcaggagaagatggaggccagc
tccatgaagctccacgacacccccatgctgtccttcaaccggccgcccatgacggccaac
gtggggcccatgagcaactccctcccgcttgacccgtggctgacgtcgcccatctccagc
gccaccccggtgcacagcatccccggcttcatgggagccccccaggccctgcagcccccc
tatggcgggcactccttcctcaacacccccccgggcatggctcagggcatgcagcccatg
gcccccgcgccctaccagtgcggcaccccctttgtggacaagtacccgctggaggacgtc
gaccagaggagctccagcatcgcctcgctccgcatgaaagccaaggagcacattcagacc
atcgacaagacctggcagcccatttga

DBGET integrated database retrieval system