KEGG   Gallus gallus (chicken): 373907
Entry
373907            CDS       T01006                                 

Gene name
AHR
Definition
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373907 (AHR)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    373907 (AHR)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_4 PAS_9
Other DBs
NCBI-GeneID: 373907
NCBI-ProteinID: NP_989449
CGNC: 8232
Ensembl: ENSGALG00000010836
UniProt: F1NLX8 Q9I9E2
Position
2
AA seq 858 aa
MNPNVTYASRKRRKPVQKIVKPSPAEGVKSNPSKRHRDRLNAELDRLASLLPFPQDVIAK
LDKLSVLRLSVSYLRAKSFFDVALKSSNSTRLERNGIQESRTAKLGEGMQILEGELLLQA
LNGFVLVVTADALVFYVSSTIQDYLGFQQSDIIHQSVFELIHTEDRPEFQRQLHWALNPA
QSADSGPSVQGDNGFSQPANYYNPDQLPPENSSFMERNFICRLRCLLDNSSGFLAMNFQG
RLKFLHGQNKKGKDGAALSPQLALFAVATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCD
AKGKIVLGYTEAELCMRGTGYQFIHAADMLYCAENHVRMMKTGESGMTVFRLLTKENRWA
WVQANARLVYKNGRPDYIISTQRPLTDEEGAEHLRKRNMKLPFMFATGEAVLYELTFPMS
SLSDTSQPRSKTTTGKGGKTTLHGDSVDPNSLLGAMLRQDESVYLCPPASHKLSFERNFF
ADSRDELSGVVSSDWTDSLLPAGSHNILKQELMECSQDSSVPLPEDSAALFQDNKTNDLY
SIMKNLGIDFEDLKCIQQDEEFFKTELSGMDDIGDIDITDEILTYVQDSLNKSDFLYSGC
NQQQPLVQNAGCLVQQELDQHQIHQHQKQLMEQQQQQQQQLCQKMKHMQVNGMFTNWSSG
TSMPLCSPQQPQQYTFPGMQATAAEFSYKSEVNASPYACRQEFVPYKQPTAMMPQLSNFS
QMDFPVAGLDRSAYSASSNLEDFLGCLQQVPENLDCGINSESVMLTPQTCYAGAVSMYQC
TQEAQPNCMDQMQYDPMMANQQTLLNKFQNGFNGGNVNEAYPSQLDVISNSQTATHLQPV
HHPTEPRSFPDLASSGFM
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgaaccccaatgtcacctacgccagtcgcaagcggcggaaacctgtgcagaaaatagta
aagccatctccagctgaaggagtcaaatccaacccatccaagaggcacagggaccgtttg
aatgcggagttggatcgcttggcaagccttctgcctttccctcaggatgttatcgccaaa
ttggataagttgtctgtgcttaggctcagcgtcagttacttgcgagccaagagttttttt
gatgttgcattaaaatcttcaaactctacaagactagaaagaaatggcattcaggaaagc
agaacagcaaaacttggagaggggatgcagatcctggaaggagagctcttactgcaggca
ttaaatggcttcgtattagttgtgacggcagatgctctggttttttacgtctcatctacc
atccaagactacctgggtttccaacaatctgatattatacaccagagtgtatttgaattg
attcacactgaagacagacctgagtttcaacgtcagctacactgggcattaaatcctgcc
cagtctgcagattctggaccgagtgtgcaaggagataatggcttttcacagccagcaaac
tattataacccagaccaacttcctccagagaattcttcctttatggaaaggaatttcatc
tgcagattacgatgtctcctggataactcatctgggtttctggctatgaattttcaagga
cgattaaagtttcttcatggacagaacaagaaagggaaggatggtgctgcattgtctcct
cagctggctctgtttgcagtagctactcccctgcaaccaccttccatccttgagataaga
accaaaaactttatcttcagaacaaaacacaaactggatttcacacctactggctgtgat
gcaaaaggaaagattgtcttgggatacactgaagcagagctgtgtatgagaggaacagga
taccagttcattcatgcagctgatatgctttattgtgctgaaaatcatgtccgaatgatg
aagacgggtgagagtggaatgactgtcttcaggcttctaaccaaagaaaatcggtgggcc
tgggtacaggcaaatgcacgccttgtctataaaaatggaagaccagattacattatttcc
acacaaagacctcttacagatgaagaaggagcagaacatctacggaagcgtaacatgaag
ttgcccttcatgtttgccactggtgaggctgtgttatatgagctaactttccctatgtcc
agcttatcggatacctctcagccaaggagtaaaaccaccacaggaaaaggaggcaaaact
acattacatggggattctgtggatccaaactccctcctaggtgccatgttaaggcaagat
gagtctgtgtatctctgtcctccagcatcacacaaactttcctttgagcggaacttcttt
gcagacagcagggatgaactgagtggtgttgttagcagtgactggacagatagcctccta
cctgctggaagtcacaatattctcaagcaggaactaatggagtgttcccaggacagtagt
gtgccacttcctgaagacagtgcagcgctctttcaagataacaaaacaaatgatttgtac
agcatcatgaaaaatctgggtattgactttgaagatctaaagtgtattcagcaggatgag
gagttttttaaaactgaattatctggtatggatgatattggggacatcgacataactgat
gaaatcctgacttatgtgcaggattccttaaataagtctgacttcttatattcgggctgt
aatcagcagcagcccctggtccagaatgctggttgcttggtacagcaagaattagatcag
catcaaattcatcagcatcagaaacagctcatggagcagcagcaacagcaacagcagcag
ctctgtcagaaaatgaaacatatgcaagtcaatgggatgttcacaaattggagctctggc
accagcatgcctctttgctcaccgcagcagccccagcaatacacgttccctggcatgcaa
gccactgctgctgagttttcttacaaatcagaagtaaacgcttcaccttatgcatgtagg
caagaatttgttccttacaagcaacccacagcaatgatgcctcagctttctaacttttcc
caaatggatttccctgtagcaggtcttgacagatcagcctattctgcttcttccaacttg
gaggattttcttggttgtttgcagcaggtccctgaaaaccttgactgtgggataaattct
gagtcggttatgctaaccccccaaacatgttatgcaggtgccgtttctatgtaccagtgc
acacaagaagcacagccaaactgcatggatcaaatgcaatatgatcccatgatggcaaat
cagcaaacattgttaaacaagttccaaaatggcttcaatggaggaaatgtaaatgaagca
tatccctctcagttagatgtgataagtaattcacagactgccacacatcttcaacccgtt
catcatccaacagagcccagatccttcccagatttggcatctagtggatttatgtaa

DBGET integrated database retrieval system