KEGG   Gallus gallus (chicken): 373910Help
Entry
373910            CDS       T01006                                 

Gene name
NHLH1
Definition
(RefSeq) helix-loop-helix protein 1
  KO
K09075  nescient helix-loop-helix protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373910 (NHLH1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, HEN
    373910 (NHLH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Nore1-SARAH SecM
Motif
Other DBs
NCBI-GeneID: 373910
NCBI-ProteinID: NP_989452
CGNC: 66179
Ensembl: ENSGALG00000025817
UniProt: Q9PWD7
Position
25
AA seq 130 aa AA seqDB search
MLNSEQTELDLPPAHSEPESVFSDCGRVGGAEESGVALCPQPRGAEQAEAVKKDLQHLSR
EERRRRRRTTAKYRTAHATRERIRVEAFNMAFAELRKLLPTLPPDKKLSKIEILRLAICY
ISYLNHVLDV
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgctcaactcggagcagacagagctcgacctcccgcccgcgcactccgagcccgaatcc
gtcttcagcgactgcggccgcgtgggcggcgcggaggagtccggcgtcgctttgtgccct
cagccccgcggggccgagcaggcagaggcggtgaagaaggacctgcagcacctgagccgg
gaggagcggcggcggcggcggcgaaccacggccaagtaccgcacagcccacgccacgagg
gaacgcatccgcgtggaagccttcaacatggccttcgccgagctgcgcaagctgctgccc
acgctgccgcccgacaagaagctctccaagattgagatccttcgcctggctatctgctac
atctcctacctgaaccacgtgctggatgtctga

DBGET integrated database retrieval system