KEGG   Gallus gallus (chicken): 373911
Entry
373911            CDS       T01006                                 

Gene name
PTPRO
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase O
  KO
K18035  receptor-type tyrosine-protein phosphatase O [EC:3.1.3.48]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    373911 (PTPRO)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     373911 (PTPRO)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    373911 (PTPRO)
SSDB
Motif
Pfam: Y_phosphatase fn3 Y_phosphatase3 DSPc PTPlike_phytase Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 373911
NCBI-ProteinID: NP_989453
CGNC: 9894
Ensembl: ENSGALG00000013085
Structure
PDB: 
2PI7

Position
1
AA seq 1268 aa
MLPQFTIAGHGSEPGGGRRGAAARGRGAEEPQPPPPGRSRGPRPPRSPMPDRRRRGARGG
PGARSCLLWLFVLLKNAEPFQVIVQEDNCIVVSLEAFDVVSSSSVYVVKIAGESKNYFFQ
FEEFNSTLPAPVIFNAKYHGLYYIVTLLVVNSNMVSKSARSITVLTKPLPVSSVSIYDYK
PSPETGVLFEIQYPEKYNVFTRVNISYWEGKDYRTMLYKDFFKGKTVFNHWLPGICYSNI
TFQLVSEATFNKSTLVEYSGVRHEPKQHRTVPYPPRNISVQIVPINRNNWEEHSGNFAEE
SFMGQQEIISKEKLSRFPSDPPEIPVVNTTAAWPDYRSNSTEYETTSQPYWWSNEAESSE
GEEEFVNAVPRDYGASEANASGKLTAEPAPFLPVQMVLTWLPPKPPTAFDGFHINIEREE
NSTELLTVSEDTHKFVAELKEPGKYKLSVTTFSSSGSCEVRGSQSAKTLSFYISPTGEWI
EELTEKPQHVTVTVLSSTTALTSWTASHESGSNGTIVSVVSLTCQKQKESQRLEKHYCTE
VNSSSSLIENLVPGAQYQVVVYLRKGPLVGPPSDPVTFSIVPTGIKDLTLYPLGPTAVVL
SWNRPFLGVFRKYVVEMFYFNPSTMTSEWTTYYEIAATISLTASVRIANLLPAWYYNFRV
TMVTWGDPELSCCDSSTISFITAPVAPEITSIEYYNHLLYVTWTYGGDGTDLSHSRMLHW
MVIAEGKKKIKKSVTRSVMTAVLSLPPGDIYNLSVTACTERGSNTSLPQLVKLEPAPPKS
LFAVNKTQTSVTLLWVEEGVADFFEVYCQQAGSNQEVKVQEPVTVSSHVVTISSLTPATS
YNCSVTTFSHNSPSVPTYIAVSTMVTEMNPNIVVISVLAILSILLIGLLLVTLVVLRRKH
LQMARECGAGTFVNFASLERDGKLPYNWRRSVFAFLTLLPSCLWTDYLLAFYINPWSKNG
LKKRKLTNPVQLDDFDGYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPMNRCKNRY
TNILPYDFSRVRLVSMNEEEGSDYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQ
KSQIIVMLTQCNEKRRVKCDHYWPFTEDPIAYGDITVEMLSEEEHTDWVYRNFRISYADE
VQDVMHFNYTAWPDHGVPTANAAESILQFVQMVRQKSVKSKGPMIIHCSAGVGRTGTFIA
LDWLLQHIRDHEFVDILGLVSDMRSYRMSMVQTEEQYIFIHQCVQLMWQKKKQQFCISDV
IYENVSKS
NT seq 3807 nt   +upstreamnt  +downstreamnt
atgctgccgcaattcaccattgccgggcacggctcggagccgggcggagggaggcgaggg
gcagcggcgaggggccggggggcagaggagccgcagccccccccgcccggccgctcccgc
gggccgcggccgccgcgctccccgatgcccgaccgccgccggcggggagcccggggtgga
ccgggggcccgctcctgcctgctctggctctttgtgctgctaaagaatgcagaacctttc
caagttattgtccaagaagacaattgtattgttgtctccctggaagcatttgatgtggtg
agctcatcctctgtatatgttgtgaagatagctggagaatccaagaactactttttccag
tttgaagaattcaatagcactttacctgcccctgtgatttttaatgccaaataccatggc
ctctattacatagtaactctgttggtagtgaactcaaatatggtttccaagtcagcaaga
tcaatcactgtgttaaccaaaccccttcctgtgagcagtgtttctatctatgattacaaa
ccatctccagaaacaggagtgctgtttgaaattcaatacccagagaagtacaatgttttt
accagggtaaatataagctattgggaaggaaaagactacagaacaatgctgtacaaagat
ttctttaaaggtaaaaccgttttcaatcactggctgccaggtatatgctacagtaacatc
acatttcaattggtatcagaagcaaccttcaacaaaagcacactagtggaatacagtggg
gttaggcatgagcccaagcagcacagaacagttccttacccacctcgaaacatttctgtt
cagattgtgccaatcaacagaaacaattgggaagagcacagcgggaattttgcagaagaa
tcattcatgggacaacaagaaatcataagcaaagagaaactgagccgctttcctagtgac
ccacctgaaattccagtagtgaacacaactgcagcctggcccgattaccgttctaacagt
actgagtacgaaaccacatcacagccatattggtggtctaatgaagctgaatcatcagag
ggtgaagaggagtttgtcaatgcagttcccagggattatggggccagtgaagcaaatgca
tctggaaaactcacagcagagcccgctcctttccttcctgtacaaatggtgctgacttgg
ttaccaccaaaaccaccaactgcctttgatggtttccacatcaacattgaaagagaagag
aactccacagaacttctgacagtcagcgaagacactcacaaatttgttgctgaactgaaa
gaaccaggaaaatataagttgtctgtaacaacatttagctcctctggctcttgtgaagtt
cggggaagtcaatcagcaaaaacactcagcttttatatcagccccacgggtgaatggata
gaagagctcacggaaaagccccagcatgtgacggtgacagtgctcagctccactactgcc
ctgacttcctggacagcctcacatgagagtggtagcaatggcacgatcgtgtccgtggtc
tccttgacttgtcagaagcaaaaggaaagtcaaaggcttgaaaaacattactgcacagag
gtaaattcaagcagcagcctcattgaaaatcttgttcctggtgcccagtaccaggttgtg
gtttacttacggaaaggaccgttggttggaccaccctctgatcctgttacattttccatt
gtgcccactggaataaaggatctgactctgtaccctttgggacctactgctgtggttttg
agctggaacagacctttccttggggtgttcaggaaatatgtggtagaaatgttttacttc
aatccatcaacaatgacatctgagtggacaacctactatgaaatagcagcaaccatctcc
ctaactgcctctgtgaggatagctaacctgctgcctgcgtggtactacaatttccgggtc
accatggtgacctggggagacccagagctgagctgctgtgacagctccaccatcagcttc
ataacagcaccagtggcacctgagattacctccatagaatattacaaccaccttttgtac
gtcacctggacctatggaggagatggtactgacctctctcattccaggatgctgcattgg
atggtcattgcggaaggaaagaaaaaaatcaagaagagtgtaacacgcagcgtgatgact
gcagtgttgagtttgcctccaggggacatttacaacctttcagtaactgcttgtactgaa
agaggcagcaatacctccctgccccagcttgtgaaattggaaccagcacctccaaagtca
ctgtttgctgtcaacaagactcagacctctgtcactctactgtgggtggaagaaggagtg
gctgatttctttgaagtctattgccagcaggctggatccaatcaagaagttaaagtccag
gaacctgtcactgtctcttcacatgtagtgactatttccagcctaactcctgccacctcc
tacaactgcagcgtgaccaccttcagccacaatagccccagtgttcccacatacattgcg
gtttccaccatggtcactgagatgaatcccaacatagtggtaatctctgtgttagccatt
ctaagtatccttctcattggactgctgctggtgacccttgttgtgcttaggaggaaacat
ctacaaatggccagggagtgcggggctggaacctttgtcaattttgcatcattagagaga
gatggaaagctaccatataactggcgtagaagtgtatttgctttcctaactctgctaccc
tcatgcctttggactgattatcttttggcattttatattaatccttggagtaaaaacgga
ctaaagaagagaaagctgaccaaccccgtccagttggatgattttgatggctacatcaag
gatatggccaaagattctgattataaattttctctgcaatttgaggagctaaaactgatt
gggcttgatatacctcactttgccgctgatcttcccatgaatcgctgcaaaaatcgctac
acaaatatcctgccatatgactttagtcgcgtccggttagtctcaatgaatgaagaagag
ggatctgactacattaatgccaactatattcctggttataattcaccccaggaatacata
gcaacccaaggaccactgccagaaactaggaatgatttttggaagatggttcttcagcaa
aaatctcaaattattgttatgctcactcagtgcaatgagaaaaggcgggtgaaatgtgat
cattactggccttttacagaagatcctattgcatacggggacattactgtcgagatgctg
tctgaggaagaacacacagattgggtttataggaatttccgaattagctatgctgatgag
gtgcaagacgtgatgcattttaactacactgcctggccagaccatggtgtccccacagcc
aatgccgccgaaagcatcctgcagttcgtgcagatggtcaggcagaagtcagtaaagagt
aaaggccccatgatcatacactgcagtgctggagtgggacgaacaggaacattcatagcc
ctggactggctcttacagcacatccgtgaccatgagtttgtagatatattgggcctggtg
tctgacatgaggtcctacagaatgtccatggtgcagacagaggaacaatacatttttatt
caccagtgtgtgcaattgatgtggcaaaagaagaagcagcagttctgcataagcgacgtc
atatatgagaatgtcagcaagtcctag

DBGET integrated database retrieval system