KEGG   Gallus gallus (chicken): 373920Help
Entry
373920            CDS       T01006                                 

Gene name
MID1
Definition
(RefSeq) E3 ubiquitin-protein ligase Midline-1
  KO
K08285  midline 1 [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    373920 (MID1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    373920 (MID1)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     373920 (MID1)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    373920 (MID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY PRY zf-B_box fn3 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-RING_2 zf-RING_5 Pur_ac_phosph_N fn3_4 U-box Baculo_PEP_C
Motif
Other DBs
NCBI-GeneID: 373920
NCBI-ProteinID: NP_989460
CGNC: 48957
Ensembl: ENSGALG00000038504
UniProt: Q71R46
Position
1
AA seq 667 aa AA seqDB search
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCASNEPVESITAFQCPTCR
YVITLSQRGLEGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDSNSMSSCEKVLCQ
FCDQDPAQEAVKTCVTCEVSYCEECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHREHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQETKLMEECDQLIEIIQQRRQIIGTKIKEGKVVRLRKLAQQIA
NCKQCIERSTSLISQAEQSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFTREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDETSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGISYKSAPKHEWIGKNSASWVLCRCNNTWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSLAFYDALNSLHLYTFDITFGQPVCPTFTVWNKCLTIITGLPIPDHL
DSSEQLA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggaaacactggagtcggaactgacctgccctatctgtctcgagctgtttgaggacccg
ctgctgctgccctgcgctcacagtctctgcttcaactgcgcgcaccgcatcctggtctcc
cactgcgcctccaacgagccggtggagtctatcaccgccttccagtgccccacctgccgc
tatgtcatcaccctcagccagcgcggtctagaggggctcaagcgcaacgtcaccctgcag
aacatcatcgaccgctttcagaaagcctcggtgagcgggcccaactcccccagcgagacc
cgtcgggagcgggcattcgacagcaacagcatgtcctcctgcgagaaggtcctctgccag
ttctgcgaccaggaccctgcccaggaggcagtgaagacgtgcgtgacctgcgaggtctcc
tactgcgaggagtgcctgaaagccacgcaccccaacaagaagcctttcaccggccatcgg
ctgatcgagcccatcccggactctcacatcaggggattaatgtgcttggagcacgaggac
gagaaggtgaacatgtactgcgtgacagatgaccagctgatttgcgccctgtgcaagctg
gtcgggcggcaccgggaacatcaagtggcagctctaagcgagcgctacgacaagctgaag
caaaatttggagagtaacctcaccaaccttattaagaggaatactgaactggaaactctt
ctggcaaaactcattcagacctgtcaacatgtagaagtaaatgcatctcgccaagaaacc
aagctgatggaagaatgtgaccagctcattgaaataatacaacagagacgacaaataatt
ggaaccaaaatcaaggaaggaaaggtggtgaggttgagaaaactggctcagcagattgca
aactgcaagcagtgcatcgagcgctcgacatccctcatctctcaggctgagcagtcgctg
aaggagaatgatcatgctcgcttcctgcaaactgctaaaaacatcaccgaaagggtttcc
atggcaactgcatcctcccaggttctaattcctgaaattaatctcaacgatacttttgat
actttcgcacttgattttaccagggagaagaaattgttggaatgccttgattatcttaca
gctcccaaccctcccaccattcgagaagagctctgtacagcttcttatgatactattact
gtccactggacatcagacgatgagttcagcgtggtctcttacgagctgcagtacaccatc
ttcactggacaagctaacgttgttagtttatgtaactcagccgacagctggatgattgtt
cccaatatcaaacaaaaccactacaccgtgcatgggttacagagtggcacaaagtacatc
ttcattgttaaggctattaatcaggctggcagcagaagcagcgagccaggcaagctcaag
acaaacagtcagccatttaaactggaccccaaatctgctcatagaaagctgaaagtgtct
catgacaacttgacagtggaacgtgatgaaacctcctccaaaaagagtcatacaccagag
cgattcacgagccaagggagctacggagtagctggcaatgtattcattgacagtggacgg
cattactgggaagtggttataagtgggagtacatggtatgccattggtatttcatacaag
tcagcaccgaagcatgagtggatcgggaagaactcagcctcctgggtgctgtgccgctgc
aacaacacatgggtggtgagacacaacagcaaagaaatcccaatagagcctgcgcctcat
ctccgccgtgtcggcattttgctggactacgacaatggttcccttgctttttatgatgcc
ttgaactccctgcacctttacacctttgacattacgtttgggcagcccgtctgccccaca
ttcactgtgtggaataagtgtttgaccattataacaggcttgcccatccctgatcactta
gattcctctgagcagctggcatga

DBGET integrated database retrieval system