KEGG   Gallus gallus (chicken): 373924
Entry
373924            CDS       T01006                                 

Gene name
CACNG4
Definition
(RefSeq) voltage-dependent calcium channel gamma-4 subunit
  KO
K04869  voltage-dependent calcium channel gamma-4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    373924 (CACNG4)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    373924 (CACNG4)
   04261 Adrenergic signaling in cardiomyocytes
    373924 (CACNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    373924 (CACNG4)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   373924 (CACNG4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 AA_permease_2 DUF2269 DUF4199
Other DBs
NCBI-GeneID: 373924
NCBI-ProteinID: NP_989463
CGNC: 66180
Ensembl: ENSGALG00000026091
UniProt: Q90X18
Position
18
AA seq 328 aa
MVWCDRGVQMLLTTVGAFAAFSLMAIAIGTDYWLYSSAHICNGTNITTDDTQGPPKKARG
DLTHSGLWRICCLEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLL
LGGLCVGAGRIYNSKNNIILSAGILFVAAGLSNIIGIIVYISSNAGDPSDKRDEDKKNHY
NYGWSFYFGALSFIVAETIGVLAVNIYIEKNKELRFKTKREFLKTSSSSPYARMPSYRYR
RRRSRSSSRSTEPSPSRDISPVGMKIASTIPMNEISMYTLSREPLKVTTAASYNADQEAS
FLQVHNFLQKEFKEGLHVNMVNRRTTPV
NT seq 987 nt   +upstreamnt  +downstreamnt
atggtgtggtgtgaccgtggcgtccagatgctgctgaccacggtgggagctttcgccgct
ttcagcctcatggccatcgccatcggtaccgactactggctgtactccagcgcgcacatc
tgcaacggcaccaacatcacgacggacgatacgcaggggccgccgaagaaagcgaggggc
gacctcacgcattcggggctctggaggatctgctgcctcgaaggaatctacaaaggacac
tgcttccgaatcaaccacttccctgaagacaacgactacgaccatgacagctcagaatac
cttctccgcattgtccgtgcctccagtgtgttccccattctaagcacaatattgctgctg
ctgggagggctctgtgttggagcagggaggatttacaacagcaaaaacaacattattctc
agcgctggaattctctttgtcgcagcaggcctaagtaatatcatagggatcattgtctac
atatcaagcaacgcaggtgacccaagtgataagcgagatgaggacaaaaagaaccattac
aactacggttggtctttctattttggagccttgtcttttatcgtggccgaaaccataggt
gttctggctgtgaacatttatattgagaagaacaaagagctgaggtttaagaccaagagg
gaattccttaagacttcttccagttctccttatgccaggatgccaagctacaggtacagg
aggcggaggtccaggtccagttctcgatccacagaaccttctccatctagagacatttcc
ccggttggcatgaagatagcaagcaccattcccatgaacgagatttccatgtacactctt
tccagagagcccttgaaggtcacaacggccgccagctacaacgcagaccaagaagccagt
tttctgcaggtccacaacttccttcagaaggaatttaaggaaggactccacgtcaacatg
gtcaacaggagaacaacacctgtctga

DBGET integrated database retrieval system