KEGG   Gallus gallus (chicken): 373930Help
Entry
373930            CDS       T01006                                 

Gene name
SUMO1
Definition
(RefSeq) small ubiquitin-related modifier 1 precursor
  KO
K12160  small ubiquitin-related modifier
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    373930 (SUMO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    373930 (SUMO1)
   03029 Mitochondrial biogenesis [BR:gga03029]
    373930 (SUMO1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    373930 (SUMO1)
Ubiquitin system [BR:gga04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   373930 (SUMO1)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    373930 (SUMO1)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    373930 (SUMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 373930
NCBI-ProteinID: NP_989466
CGNC: 48961
Ensembl: ENSGALG00000008435
UniProt: Q8QGH2
Position
7
AA seq 101 aa AA seqDB search
MSDQEAKPSAEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRITDNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccaggaagcaaagccttcagctgaggacttaggagataagaaagagggggaa
tacattaaactcaaagtcattgggcaggacagcagtgaaattcacttcaaggtgaaaatg
acaacacacctcaagaaactcaaagaatcatactgtcaaagacagggtgttccaatgaac
tcactcaggtttctcttcgagggtcagagaattactgataatcatacccccaaggagctg
gggatggaggaggaagatgtgattgaagtttatcaggaacagacggggggtcactcaaca
gtttag

DBGET integrated database retrieval system